KEGG   Bos indicus (zebu cattle): 109577428
Entry
109577428         CDS       T04792                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01523  Antifolate resistance
biu04010  MAPK signaling pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04064  NF-kappa B signaling pathway
biu04071  Sphingolipid signaling pathway
biu04150  mTOR signaling pathway
biu04210  Apoptosis
biu04217  Necroptosis
biu04350  TGF-beta signaling pathway
biu04380  Osteoclast differentiation
biu04612  Antigen processing and presentation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04640  Hematopoietic cell lineage
biu04650  Natural killer cell mediated cytotoxicity
biu04657  IL-17 signaling pathway
biu04660  T cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04668  TNF signaling pathway
biu04920  Adipocytokine signaling pathway
biu04930  Type II diabetes mellitus
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04940  Type I diabetes mellitus
biu05010  Alzheimer disease
biu05014  Amyotrophic lateral sclerosis
biu05132  Salmonella infection
biu05133  Pertussis
biu05134  Legionellosis
biu05135  Yersinia infection
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05143  African trypanosomiasis
biu05144  Malaria
biu05145  Toxoplasmosis
biu05146  Amoebiasis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05205  Proteoglycans in cancer
biu05310  Asthma
biu05321  Inflammatory bowel disease
biu05322  Systemic lupus erythematosus
biu05323  Rheumatoid arthritis
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05410  Hypertrophic cardiomyopathy
biu05414  Dilated cardiomyopathy
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109577428 (TNF)
   04350 TGF-beta signaling pathway
    109577428 (TNF)
   04064 NF-kappa B signaling pathway
    109577428 (TNF)
   04668 TNF signaling pathway
    109577428 (TNF)
   04071 Sphingolipid signaling pathway
    109577428 (TNF)
   04150 mTOR signaling pathway
    109577428 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109577428 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109577428 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109577428 (TNF)
   04217 Necroptosis
    109577428 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109577428 (TNF)
   04620 Toll-like receptor signaling pathway
    109577428 (TNF)
   04621 NOD-like receptor signaling pathway
    109577428 (TNF)
   04622 RIG-I-like receptor signaling pathway
    109577428 (TNF)
   04625 C-type lectin receptor signaling pathway
    109577428 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    109577428 (TNF)
   04612 Antigen processing and presentation
    109577428 (TNF)
   04660 T cell receptor signaling pathway
    109577428 (TNF)
   04657 IL-17 signaling pathway
    109577428 (TNF)
   04664 Fc epsilon RI signaling pathway
    109577428 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109577428 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109577428 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109577428 (TNF)
  09163 Immune disease
   05310 Asthma
    109577428 (TNF)
   05322 Systemic lupus erythematosus
    109577428 (TNF)
   05323 Rheumatoid arthritis
    109577428 (TNF)
   05321 Inflammatory bowel disease
    109577428 (TNF)
   05330 Allograft rejection
    109577428 (TNF)
   05332 Graft-versus-host disease
    109577428 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109577428 (TNF)
   05014 Amyotrophic lateral sclerosis
    109577428 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109577428 (TNF)
   05410 Hypertrophic cardiomyopathy
    109577428 (TNF)
   05414 Dilated cardiomyopathy
    109577428 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109577428 (TNF)
   04940 Type I diabetes mellitus
    109577428 (TNF)
   04932 Non-alcoholic fatty liver disease
    109577428 (TNF)
   04931 Insulin resistance
    109577428 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109577428 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109577428 (TNF)
   05135 Yersinia infection
    109577428 (TNF)
   05133 Pertussis
    109577428 (TNF)
   05134 Legionellosis
    109577428 (TNF)
   05152 Tuberculosis
    109577428 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577428 (TNF)
   05170 Human immunodeficiency virus 1 infection
    109577428 (TNF)
   05164 Influenza A
    109577428 (TNF)
   05161 Hepatitis B
    109577428 (TNF)
   05160 Hepatitis C
    109577428 (TNF)
   05168 Herpes simplex virus 1 infection
    109577428 (TNF)
   05163 Human cytomegalovirus infection
    109577428 (TNF)
   05169 Epstein-Barr virus infection
    109577428 (TNF)
   05165 Human papillomavirus infection
    109577428 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109577428 (TNF)
   05144 Malaria
    109577428 (TNF)
   05145 Toxoplasmosis
    109577428 (TNF)
   05140 Leishmaniasis
    109577428 (TNF)
   05142 Chagas disease
    109577428 (TNF)
   05143 African trypanosomiasis
    109577428 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    109577428 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109577428 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109577428 (TNF)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Tumor necrosis fators
   109577428 (TNF)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Cytokines
   109577428 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 109577428
NCBI-ProteinID: XP_019841916
Position
23
AA seq 333 aa
MGFSTKEVFRWLNESLSPPSSHPTAYKCSCLHTQPTEAPRAGTPGDQPGERQAAAEPPGD
NLPDNTPPRDSQATCSLSHTLPQGSPVSRLDLNPSEKDTMSTKSMIRDVELAEEVLSEKA
GGPQGSRSCLCLSLFSFLLVAGATTLFCLLHFGVIGPQREEQSPGGPSINSPLVQTLRSS
SQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLF
RGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVF
QLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgggtttctccaccaaggaagttttccgctggttgaatgagagcctttccccgccctct
tctcaccccacagcatataaatgcagctgtttgcacacccagccaacagaagctcccaga
gcggggacaccaggggaccagccaggagagagacaagcagctgcagaaccccctggagat
aacctcccagacaacacacccccgagagacagccaggcaacttgctctctctcacatacc
ctgccacaaggctctcctgtctcccgtctggacttgaacccttctgaaaaagacaccatg
agcaccaaaagcatgatccgggatgtggagctggcggaggaggtgctctccgagaaagca
gggggcccccagggctccagaagttgcttgtgcctcagcctcttctccttcctcctggtt
gcaggagccaccacgctcttctgcctgctgcacttcggggtaatcggcccccagagggaa
gagcagtccccaggtggcccctccatcaacagccctctggttcagacactcaggtcctct
tctcaagcctcaagtaacaagccggtagcccacgttgtagccgacatcaactctccgggg
cagctccggtggtgggactcgtatgccaatgccctcatggccaacggtgtgaagctggaa
gacaaccagctggtggtgcctgctgacgggctttacctcatctactcacaggtcctcttc
aggggccaaggctgcccttccacccccttgttcctcacccacaccatcagccgcattgca
gtctcctaccagaccaaggtcaacatcctgtctgccatcaagagcccttgccacagggag
accccagagtgggctgaggccaagccctggtacgaacccatctaccagggaggagtcttc
cagctggagaagggagatcgcctcagtgctgagatcaacctgccggactacctggactat
gccgagtctgggcaggtctactttgggatcatcgccctgtga

DBGET integrated database retrieval system