KEGG   Bos indicus (zebu cattle): 109577593
Entry
109577593         CDS       T04792                                 

Gene name
MPZL1
Definition
(RefSeq) myelin protein zero-like protein 1 isoform X1
  KO
K06770  myelin protein zero
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577593 (MPZL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109577593 (MPZL1)
Cell adhesion molecules [BR:biu04515]
 Immunoglobulin superfamily
  P0
   109577593 (MPZL1)
SSDB
Motif
Pfam: V-set ig Ig_3 Adeno_E3_CR2 Rax2 I-set EphA2_TM TMIE PTP_tm
Other DBs
NCBI-GeneID: 109577593
NCBI-ProteinID: XP_019841953
Position
3
AA seq 269 aa
MAAPAGAGALIASPDRRRCLWSVLAAALGLLTYGVSALEVYTPKEIFVANGTQGKLTCKF
KSTNTTGTLTSVSWSFQPEGTDTTVSFFHYSQGQVYAGNYPPFKDRISWAGDLDKKDASI
NIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKEILPAFPVWVVVGIVTAVVLGLT
LLITMILAVXYRRRNSKRDYAGCNTSENVSPVKQVSRKSPSDTEGLVKSLPSGSHQGPVI
YAQLDHSGGHHSDRINKSESVVYADIRKN
NT seq 810 nt   +upstreamnt  +downstreamnt
atggcagcgcccgccggggccggagcactgattgcatccccagaccgccggcgctgtctg
tggtcggtgctggcggcggcgctcgggctcttgacatacggtgtatcggccttggaggtg
tatacaccaaaagaaatcttcgtggcaaatgggacacaagggaagctgacgtgcaagttc
aagtctactaacacaaccggcacgttgacctcagtctcctggagtttccagccagagggg
actgacaccacagtgtcgtttttccactactcccaagggcaagtgtatgctgggaattat
ccaccttttaaggacagaatcagctgggctggagaccttgacaagaaagatgcatcaatc
aacatagaaaatatgcagtttattcacaatggcacctacatctgtgatgtcaaaaaccct
cctgacattgttgtccagccaggacacattaggctctatgttgtagagaaagagattttg
cctgcatttccagtttgggtagtggtgggtatagttactgccgtggtcctaggyctcact
ctgcttatcaccatgattctggctgtcrtctatagaaggagaaactctaaacgggattat
gctggctgcaatacatcagagaatgtgtcaccagttaagcaggtttcacggaagtctccc
tccgacacagagggtctagtaaagagcctgccttctggatctcaccagggcccagtcata
tatgcgcagctagaccactctggcggacaccacagcgacaggattaacaagtcagagtct
gtggtgtacgcagacattcggaaaaattga

KEGG   Bos indicus (zebu cattle): 109578222
Entry
109578222         CDS       T04792                                 

Definition
(RefSeq) myelin protein P0
  KO
K06770  myelin protein zero
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109578222
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109578222
Cell adhesion molecules [BR:biu04515]
 Immunoglobulin superfamily
  P0
   109578222
SSDB
Motif
Pfam: Myelin-PO_C V-set Ig_2 ig Ig_3 I-set Mucin15 Amnionless Herpes_gE Protocadherin Tweety
Other DBs
NCBI-GeneID: 109578222
NCBI-ProteinID: XP_019842775
Position
3
AA seq 248 aa
MAPGAPSSSPSPILAALLFSSLVLSPVQAIVVYTDKEVHGAVGSQVTLYCSFWSSEWVSD
DLSFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPHRKDGSIVIHNLDYG
DNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLALLLFYLIR
YCWLRRQAALQRRLSAMEKGKLHKTAKDASKRGRQTPVLYAMLDHSRSTKAASEKKTKGL
GESRKDKK
NT seq 747 nt   +upstreamnt  +downstreamnt
atggctcctggggctccctcrtccagccccagtcctatcctggctgcgctactcttctcc
tccttggtgctctcccctgtccaggccattgtggtctacacagacaaggaggtccacggt
gctgtgggctcccaggtgaccctgtactgctccttctggtccagtgagtgggtttcagat
gacctctccttcacctggcgctaccagcccgaagggggccgtgatgccatctcgatcttc
cactacgccaagggacagccctacatcgatgaggtggggaccttcaaagagcgcatccag
tgggtaggggaccctcaccggaaggatggctccattgtcatacacaacctggactatggt
gacaacggcactttcacctgtgacgtcaaaaaccccccagacatagtgggcaagacctct
caggtcacgctctatgtctttgaaaaagtgcctacgaggtacggggtggtgctgggagcc
gtgatcgggggcgtcctgggggtggtgctgttggcgctgctgcttttctacctgattcgg
tactgctggctacgcaggcaggcggccctgcagaggaggctcagtgccatggagaagggc
aaattgcacaagactgcgaaggacgcctcaaagcgcggccggcagacgccggttctgtat
gccatgctggaccacagcagaagcaccaaagctgccagtgagaagaagactaaagggctg
ggggagtctcgcaaggataagaaatag

KEGG   Bos indicus (zebu cattle): 109578251
Entry
109578251         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: myelin protein P0-like
  KO
K06770  myelin protein zero
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109578251
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109578251
Cell adhesion molecules [BR:biu04515]
 Immunoglobulin superfamily
  P0
   109578251
SSDB
Motif
Pfam: Myelin-PO_C V-set Ig_2 ig Ig_3 I-set Amnionless Herpes_gE Protocadherin Mucin15 Tweety
Other DBs
NCBI-GeneID: 109578251
NCBI-ProteinID: XP_019842830
Position
3
AA seq 293 aa
MFAVLSPVQAIVVYTDKEVHGAVGSQVTLYCSFWSSEWVSDDLSFTWRYQPEGGRDAISI
FHYAKGQPYIDEVGTFKERIQWVGDPHRKDGSIVIHNLDYGDNGTFTCDVKNPPDIVGKT
SQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLVLLLFYLIRYCWLRRQAALQRRLSAMEK
GKLHKTAKDASKRGRQTPVLYAMLDHSRSTKAASEKKTKGLGESRKDKKXRLAGRAGDRG
LGAEASKGPRVVVIEMELRKDEQSAELRPAVKSPSRTSLKNALKNMMGLDSEK
NT seq 882 nt   +upstreamnt  +downstreamnt
atgtttgcagtgctctcccctgtccaggccattgtggtctacacagacaaggaggtccac
ggtgctgtgggctcccaggtgaccctgtactgctccttctggtccagtgagtgggtttca
gatgacctctccttcacctggcgctaccagcccgaagggggccgtgatgccatctcgatc
ttccactacgccaagggacagccctacatcgatgaggtggggaccttcaaagagcgcatc
cagtgggtaggggaccctcaccggaaggatggctccattgtcatacacaacctggactat
ggtgacaacggcactttcacctgtgacgtcaaaaaccccccagacatagtgggcaagacc
tctcaggtcacgctctatgtctttgaaaaagtgcctacgaggtacggggtggtgctggga
gccgtgatcgggggcgtcctgggggtggtgctgttggtgctgctgcttttctacctgatt
cggtactgctggctacgcaggcaggcggccctgcagaggaggctcagtgccatggagaag
ggcaaattgcacaagactgcgaaggacgcctcaaagcgcggccggcagacgccggttctg
tatgccatgctggaccacagcagaagcaccaaagctgccagtgagaagaagactaaaggg
ctgggggagtctcgcaaggataagaaatagcggttagcgggccgggcgggggatcggggg
ttaggggcggaggcttccaaaggccctcgggtggtggtcatcgagatggagctacggaag
gatgagcagagcgcggagctccggcctgccgtcaagtcccccagcagaaccagcctcaag
aacgccctcaagaacatgatgggcctggactcagaaaagtga

DBGET integrated database retrieval system