KEGG   Bos indicus (zebu cattle): 109577715
Entry
109577715         CDS       T04792                                 

Definition
(RefSeq) plasminogen activator inhibitor 2-like
  KO
K19821  plasminogen activator inhibitor 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109577715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109577715
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I4: serpin family
   109577715
SSDB
Motif
Pfam: Serpin GDE_C
Other DBs
NCBI-GeneID: 109577715
NCBI-ProteinID: XP_019842030
Position
24
AA seq 416 aa
MEELYVANTIFALNFFKHLANTSANTQNLFFCPWSISSTXAMVYLGARGNTADQIAQVLQ
FNQVGVHRGTPVTPRSLSSCNFSQQIQRGTYPDAILQAQAAGVIHSSFHSLSNTINVSMG
EYLLESANKLFGEKSARFKEEYMQLSKRYYSTEPQAVDFLECAEDARKQINSWVKTQTKG
KIPNLLPEGSVDADTKMVLVNAIYFKGKWKTPFQKKLKGLYPFHVNSTQHKSVEMMFLHE
KLNIGYIADLKVQILELPYAGEVSMFLLLPDGIAESSTGLELLESEITPDKLSKWLSEDT
MGEDDVEVYIPRFKLEERYGLKTILTGMGMGDAFSQGRANFSGMSEKNDLFLSEVFHQAS
VDVNEEGTEAAAGTGAIVTGRTGHGGPQFVADHPFLFFIVHKITKSILFWGRFASP
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggaagaactttatgtggcaaatacaatctttgccctcaatttcttcaagcatctggca
aatacaagcgccaacacccagaatctcttcttctgtccctggagcatctcctccaccatn
gccatggtctacctgggcgcccggggcaatactgcagaccagatagcccaagtgcttcag
tttaaccaagttggagtccacagaggcaccccagtgaccccacggagcctcagcagttgt
aatttctcacagcagatccagaggggcacctatcctgatgctattttgcaggcacaagct
gcgggggtaatccattcatccttccattctctcagcaacactatcaacgtgtccatgggg
gagtatttattggaaagtgccaataaactgtttggagagaaatctgcaagattcaaggaa
gaatacatgcaactctccaagagatattactctacagaaccgcaggcagttgacttccta
gaatgtgcagaagatgccagaaaacagattaattcctgggtcaagactcaaaccaaaggc
aaaatcccaaacttgttacctgaaggttctgttgatgcagacaccaagatggtcctggtg
aatgctatctacttcaaaggaaaatggaagactccatttcagaagaaactaaaggggctt
tatcctttccatgtgaactcgactcagcacaaatcagtagagatgatgttcctgcatgaa
aagctaaacattggatacatagcagacctgaaggtccagattctagaactcccatatgct
ggagaggtcagtatgttcctgctgcttccagatggaattgctgaatcctctacgggcttg
gagttgctggagagtgaaatcacccctgacaaactcagcaagtggctcagcgaggacacc
atgggtgaggatgacgtggaggtgtacatccccaggttcaaactggaagagcgttatgga
ctcaagaccattctcacgggcatgggcatgggcgatgccttcagccaaggccgagccaat
ttctcaggcatgtcagaaaagaatgacctgtttctgtctgaagtgtttcatcaagcttct
gtggatgtgaacgaggagggcactgaggctgctgccggcactggggccatcgtaacaggg
agaacaggccayggaggtccgcagttcgtggcagaccatcctttcctcttctttattgtg
cacaagataaccaagagcattctcttttggggtagatttgcatcaccctaa

KEGG   Bos indicus (zebu cattle): 109577977
Entry
109577977         CDS       T04792                                 

Definition
(RefSeq) plasminogen activator inhibitor 2-like
  KO
K19821  plasminogen activator inhibitor 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109577977
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109577977
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I4: serpin family
   109577977
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 109577977
NCBI-ProteinID: XP_019842537
Position
24
AA seq 416 aa
MEELNVANTIFALNFFKHLANTSANTQNIFFCPWSISSTVAMVYLGARGNTADQIAQVLQ
FNQVGVHKGTPVTPQSLTSCDFTQQIQRDTXPDAILQAQAAGKIHSSFHSLSNAINASTG
EYLLESANMLFGEKSARFKEEYMQLSKKYYSTEPQAVDFLERAEDTRKKINSWVKTQTKG
KIPNLLPEGSVDVDTKMVLVNAVYFKGRWKTPFQKKLKGLYPFRVNSTQRKSVEMMFLNE
KLNIGYIADLKVQILELPYAGBVSMFLLLPDGIAESSTGLEMLESEITYDKLNKWLSKDT
MAEDDVVVYIPEFKLEEXYELKTILTSMGMGDAFSQGRANFSGMSGKNDLFLSEVFHQAS
VEVNEEGTEAAAGTGAIMTGRTGHGGPQFVADHPFLFFIMHKITKSILFWGRFASP
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggaagaacttaatgtggcaaatacaatctttgccctcaatttcttcaagcatcttgca
aatacaagcgccaacacccagaatatcttcttctgtccctggagcatctcctccaccgtg
gccatggtctacctgggcgcccggggcaatactgcagaccagatagcccaagtgcttcag
tttaaccaagttggagtccacaaaggcaccccagtgaccccacagagcctcaccagttgt
gatttcacgcagcagatccagagggacacctwtcctgatgctattttgcaggcacaagct
gcggggaaaatccattcatccttccattctctcagcaatgccatcaacgcrtccacgggg
gagtatttattggaaagtgccaatatgctgtttggagagaagtctgcaagattcaaggaa
gaatacatgcaactctccaagaaatattactctacagaaccccaggcggtggacttccta
gaacgtgcagaagacaccagaaaaaagattaattcctgggtcaagacccaaactaaaggc
aaaatcccaaacttgctacctgaaggttctgttgatgtagacaccaagatggtcctggtg
aatgctgtctacttcaaaggaaggtggaagactccatttcagaagaaattaaaaggactt
tatcctttccgtgtgaactcgactcagcgcaaatcagtagagatgatgttcctgaatgaa
aagctaaacattggatacatagcagatctgaaggtccagattctagaactcccatatgct
ggcratgtcagtatgttcctgctgctcccagatggaattgctgaatcctctacgggcttg
gagatgctagaaagtgaaatcacctatgacaaactcaacaagtggctcagcaaagacacc
atggcagaggatgacgtggtggtgtacatccccgagttcaaattagaagagcrttatgaa
ctcaagaccattctcacaagcatgggcatgggtgatgccttcagccagggccgagccaat
ttctcaggcatgtcgggaaagaatgacctgtttctgtctgaagtrttccatcaggcttcg
gtggaagtgaacgaggagggcactgaggctgctgccggcactggggccatcatgacaggg
agaacaggccayggaggcccgcagtttgtggcagaccatcctttcctcttctttatcatg
cacaagataaccaagagcatcctcttttggggcagatttgcctcaccctaa

KEGG   Bos indicus (zebu cattle): 109578652
Entry
109578652         CDS       T04792                                 

Gene name
SERPINE1
Definition
(RefSeq) plasminogen activator inhibitor 1
  KO
K03982  plasminogen activator inhibitor 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04066  HIF-1 signaling pathway
biu04115  p53 signaling pathway
biu04218  Cellular senescence
biu04371  Apelin signaling pathway
biu04390  Hippo signaling pathway
biu04610  Complement and coagulation cascades
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05142  Chagas disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109578652 (SERPINE1)
   04371 Apelin signaling pathway
    109578652 (SERPINE1)
   04066 HIF-1 signaling pathway
    109578652 (SERPINE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109578652 (SERPINE1)
   04218 Cellular senescence
    109578652 (SERPINE1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109578652 (SERPINE1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109578652 (SERPINE1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109578652 (SERPINE1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109578652 (SERPINE1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109578652 (SERPINE1)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109578652 (SERPINE1)
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I4: serpin family
   109578652 (SERPINE1)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109578652 (SERPINE1)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   109578652 (SERPINE1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 109578652
NCBI-ProteinID: XP_019843614
Position
25
AA seq 402 aa
MRMSPVFACLALGLALIFGEGSASYQPQSAAASLATDFGVKVFQQVVRASKDRNVVFSPY
GVASVLAMLQLTTGGETRQQIQEAMQFKIEEKGMAPAFHRLYKELMGPWNKDEISTADAI
FVQRDLELVHGFMPNFFRLFRTTVKQVDFSEVERARFIVNDWVKRHTKGMISDLLGEGAV
DQLTRLVLVNALYFNGQWKMPFPESNTHHRLFHKSDGSTISVPMMAQTNKFNYTEFTTPD
GRYYDILELPYHGNTLSMLIAAPYEKEVPLSALTSILDAELISQWKGNMTRLTRLLVLPK
FSLETEIDLRRPLENLGMTDMFRPSQADFSSFSDQEFLYVSQALQKVKIEVNESGTLASS
STALVVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMEP
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgcggatgtctccggtctttgcctgcctcgccctgggcctggccctcatctttggtgaa
gggtctgcctcctaccagccccagtctgcggcggccagcctggccacagactttggagtg
aaggtgtttcagcaggtggtgcgggcctccaaggaccgcaacgtggttttctcaccctat
ggggtggcctcagtcctggccatgctgcagctgaccacaggaggagaaacccgccagcag
atccaagaggcaatgcaattcaagattgaagagaagggcatggcccctgccttccaccga
ctgtacaaggagctcatgggcccgtggaacaaggatgagatcagcacagccgatgccatc
ttcgtgcagcgggacctagagctggtccatggtttcatgcccaacttcttcaggctgttc
cgtaccacggtcaagcaggttgacttctctgaagtggagagagccaggttcatcgtcaac
gactgggtgaaaagacacacaaaaggcatgatcagcgacttacttggtgaaggggctgtg
gaccagctgacacgcctggtcctggtaaatgccctctacttcaacggccagtggaagatg
cccttcccagagtcaaacacccaccaccgcctcttccacaagtccgatggcagcaccatc
tctgtgcccatgatggctcagaccaacaagttcaactacactgagtttaccacccccgac
ggccgttactacgacatcctggaattgccctaccacgggaacactctcagcatgctcatt
gctgccccctatgagaaggaggtgccgctctctgccctcaccagcattctggatgctgag
ctcatcagccagtggaaagggaatatgaccaggctgacccgcctcctggttctgcccaag
ttctccctggagaccgaaatcgacctcaggaggccgctggagaacttgggaatgaccgac
atgtttaggccgagccaggcggacttctccagtttttcagatcaagagtttctgtacgtg
tcgcaggcgctgcagaaagtgaagattgaggtgaatgagagcggcacgctggcrtcctcc
tccacagcccttgtagtctcagcccgaatggcccccgaggagatcatcatggacagaccc
ttcctcttcgtggtgcggcacaatcccacaggaactgtcctgttcatgggccaagtgatg
gaaccctga

DBGET integrated database retrieval system