KEGG   Bos indicus (zebu cattle): 109577771
Entry
109577771         CDS       T04792                                 

Gene name
PTPRM
Definition
(RefSeq) receptor-type tyrosine-protein phosphatase mu
  KO
K05693  receptor-type tyrosine-protein phosphatase mu [EC:3.1.3.48]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577771 (PTPRM)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109577771 (PTPRM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109577771 (PTPRM)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     109577771 (PTPRM)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    109577771 (PTPRM)
SSDB
Motif
Pfam: Y_phosphatase MAM fn3 ig PTP_tm DSPc Y_phosphatase3 I-set Ig_3 PTPlike_phytase ECSCR Ig_2 EphA2_TM DctM DUF948
Other DBs
NCBI-GeneID: 109577771
NCBI-ProteinID: XP_019842128
Position
24
AA seq 1461 aa
MSRLGTCLATLTGLLLTAAGDSFSGGCLFDEPYSTCGYSQAVDDEFNWEQVNTLTKPTSD
PWMPSGSFMLVNTSGRPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNSAPGSLNVYVKV
NNGPLGSPIWNISGDPNRTWNRAELAISTFWPNFYQVIFEVITSGHQGYLAIDEVKVLGH
PCTRTPHFLRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVQDAPLKEIKVTSSRR
FIASFNVVNTTKRDAGKYRCMIRTDGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWI
QLNANSINGDGPIVAREVEYCTASGSWSDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGE
GGTGSPGPALRTRTKCADPMRGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYC
YKVGGQEQVREEVSWDTEXSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELVVQTDED
LPGAVLTESIQGSTFEEKIFLQWREPIETYGVITLYEITYKAVSSFDPEIDLSNQSGRVS
KLGNETHFLFFGLYPGTTYSFTIRASTAKGFGPPATNQFTTKISAPSMPAYELETPLNQT
DSTVTVLLKPAHSRGAPVSVYQIVVEEERPRRTKKTTEILKCYPVPIHFQNASILNSQYY
FAAEFPANSLQAAQPFTIGDNKTYNGYWNTPLLPHKSYRIYFQAASRANGETKIDCVRVA
TKGAATPKPVPEPEKQTDHTVKIAGVIAGILLFVIIFLGVVLVMKKRKLAQKRKETMSST
RQEMTVMVSSMDKSYAEQGTSCDEAFSFMDTHNLNGRSVSSPSSFTMKTNTLSTSVPNSY
YPDPFVPTAILDETHTMASDTSSLVQPHTYKKREPADVPYQTGQLHPAIRVADLLQHITQ
MKCAEGYGFKEEYESFFEGQSAPWDSAKKDENRMKNRYGNIIAYDXHSRVRLQTVEGDNS
DYINGNYIDGYHRPNHYIATQGPMQETISDFWRMVWHENTASIVMVTNLVEVGRVKCCKY
WPDDTEIYKDIKVTLIETELLAEYVIRTFAVEKRGVHEIREIRQFHFTGWPDHGVPYHAT
GLLGFVRQVKSKSPPNAGPLVVHCSAGAGRTGCFIVIDIMLDMAEREGVVDIYNCVRELR
SRRVNMVQTEEQYVFIHDAILEACLCGDTSVPASQVRSLYYDMNKLDPQTNSSQIKEEFR
TLNMVTPTLRVEDCSIALLPRNHEKNRCMDILPPDRCLPFLITIDGESSNYINAALMDSY
KQPSAFIVTQHPLPNTVKDFWRLVLDYHCTSVVMLNDVDPAQLCPQYWPENGVHRHGPIQ
VEFVSADLEEDIISRIFRIYNAARPQDGYRMVQQFQFLGWPMYRDTPVSKRSFLKLIRQV
DKWQEEYNGGEGRTVVHCLNGGGRSGTFCAISIVCEMLRHQRTVDVFHAVKTLRNNKPNM
VDLLDQYKFCYEVALEYLNTG
NT seq 4386 nt   +upstreamnt  +downstreamnt
atgagccgacttgggacttgcctggccactttgactggacttttgctaactgcggcgggg
gactcgttttcaggtggttgcctctttgatgagccttacagcacatgtggatacagtcag
gctgtagatgatgagttcaactgggagcaagtgaacactttgaccaaaccaacctctgac
ccgtggatgccatcaggctccttcatgttggtgaacacatccgggagacccgagggacag
agagcccacctcctcctacctcagctgaaggagaatgacacccactgcattgactttcac
tactttgtgtctagcaagagtaattctgcccctgggtcactcaatgtctacgtgaaggtc
aataatgggcctttggggagccctatctggaatatatctggagaccctaaccgtacatgg
aacagggcagaactggccatcagtaccttctggcctaacttttatcaggtgatttttgaa
gtcataacttctggacatcaaggttacctcgctattgatgaagtgaaggtgttaggacat
ccgtgtaccagaacgccccacttcctgcggattcagaacgtggaggtcaacgcyggccag
tttgccaccttccagtgcagcgccatcggcaggaccgtggctggagacaggctctggcta
cagggcattgatgtccaggatgctcctctgaaggaaataaaggtgaccagttcccggcga
ttcatagcatcatttaacgtcgtgaacacaaccaaacgagatgctggaaaataccgctgc
atgattcgcactgacgggggagttggcatatccaactatgcagagttggtagttaaagag
ccccctgtccccatcgcaccccctcagctggcctccgtgggggccacctacctgtggata
caactcaacgcgaactccatcaatggggacgggcccattgtggcccgggaggtggaatac
tgcacagccagtgggagctggagtgaccggcagccggtggactccacgagctacaaaatt
gggcatctggaccccgacacggagtatgagatcagtgtgctcctcacccggcccggggag
ggcggcaccggctcccctgggcccgccctcaggaccaggaccaagtgtgctgatcccatg
cgtggcccaaggaagctggaagtcgtggaagtcaaatctcgacagatcaccatccgctgg
gagccctttgggtataacgtgacccgttgccatagctacaacctcacggtccattactgt
tacaaagttggagggcaggaacaggtgcgagaggaagtgagctgggacacagaaarctca
cacccccaacacaccatcaccaacctctcgccctataccaacgtcagcgtgaagctcatc
ctcatgaatccggaggggcggaaggagagccaggagctcgtagtacagacggatgaagat
cttccaggcgctgttcttactgaatccatccaaggaagtacctttgaagagaagatattc
cttcaatggcgagaaccaattgaaacctatggtgtcatcactctctatgagatcacctac
aaagcagtcagttcctttgacccagaaatagatctatccaatcaaagtggaagagtttca
aaactgggaaatgaaacccacttcctgtttttcggactgtatccaggaaccacgtactcc
ttcaccatccgagccagcacagctaagggctttggacccccggcaacaaatcagttcacc
accaaaatatcagcaccctccatgccggcttatgaactggagacgcccttgaatcagacg
gacagcacagtgacggtcctgctgaagcctgcacacagtcgaggtgcacccgtcagtgtc
taccaaatagtggttgaggaagagcgtcctcgaagaacgaaaaagaccacagaaatctta
aaatgctacccggtgcccatccacttccagaacgcctccatactgaattcccagtactac
ttygctgcagaattcccagccaacagcctccaagcggctcagccctttactattggtgat
aataagacttacaacgggtactggaacacccctctccttccccataaaagctacagaatt
tacttccaagcagctagtagagccaatggggaaaccaaaatagactgtgtccgagtggcc
acaaaaggagccgccactccaaaaccagtcccagaacccgagaagcaaacagaccacacg
gtcaagatcgcgggggtcatcgccggcatcctgctgttcgtgatcatatttctcggggtc
gtgctggtgatgaagaaaaggaaactggcccagaagcggaaggagacaatgagcagcaca
cggcaggagatgacggtgatggtgagctccatggacaagagctatgccgagcagggcacc
agctgcgacgaggccttctccttcatggacacgcacaacctcaacgggagatctgtgtcy
tcaccatcgtccttcaccatgaaaaccaacaccctgagcacatcggtgcccaactcctat
tacccagacccatttgtgccaactgcaattttagacgagacacacacgatggccagcgac
accagcagcctggtgcagccgcacacgtacaagaagcgcgagccggccgacgtgccctac
cagactggacagctgcaccccgccatccgggtggctgacctgctccagcacatcacgcag
atgaagtgtgccgagggctatggcttcaaggaggagtatgagagcttctttgaagggcag
tctgcaccatgggactctgctaagaaagatgaaaacagaatgaagaacagatatgggaat
attattgcctatgatsatcattcccgggtgaggctgcagaccgtagaaggagacaactca
gactacatcaatggaaattatattgatggttatcatcgacccaatcattatattgctaca
caagggccgatgcaggagacgatatctgacttctggaggatggtgtggcacgagaacaca
gcgagcatcgtcatggtgaccaacctggtggaagtggggcgggtcaaatgctgcaaatac
tggccagatgacacggagatctataaagacattaaagttaccctaatagaaacagagcta
ctggcagaatatgtgataagaacatttgctgttgaaaagcgaggcgtccacgaaatccga
gagatcagacagttccacttcacgggctggccggaccatggggtcccctaccacgccacc
gggctgctgggctttgtccggcaggtgaagtccaagagcccacccaacgcaggccctttg
gtggtgcactgcagtgctggtgcgggcaggaccggctgtttcatcgtcattgacatcatg
ctggacatggccgagcgggaaggggtggtggacatctacaactgcgtgcgggagctgcgg
tctcggagggtgaacatggtgcagaccgaggagcagtaygtgttcatccacgatgccatt
ctggaagcctgtctctgtggggacacctcggtgcccgcttcccaggtcaggtctctctac
tatgacatgaacaagctggacccacagaccaattcgagccagatcaaggaggaattccgg
accctgaacatggtgacgcctaccctgcgcgtggaagactgcagcattgcactcctgccg
cgtaaccacgagaagaaccgctgcatggacatcctgccgcctgaccgctgcctgcccttc
ctcatcaccatcgacggcgagagcagcaactacatcaacgcggccctcatggacagctat
aaacagccctcggctttcatagtcacccagcatcctctgccaaacacggtgaaagacttc
tggaggctggtcctggattatcactgcacgtctgtggtgatgctaaacgacgtggaccct
gcccagttgtgtccacagtactggccagagaatggagtccaccgacacggccccatccag
gtggagtttgtttctgctgacctggaagaagacatcatcagtaggatattccgaatctac
aacgcagcgcgaccccaggacgggtaccggatggtgcagcagttccagttcctgggctgg
ccgatgtacagggacacgccggtgtccaagcgctccttcctgaagctcatccgccaggtg
gacaagtggcaggaggagtacaacggcggggagggacgcacggtcgtgcactgcctgaat
gggggcggccgcagtgggaccttctgtgccatcagcatcgtctgcgagatgctccggcac
cagcgaacggtggatgtcttccatgccgtgaagacrctgaggaacaacaagcccaatatg
gtggacctgctggatcagtacaagttctgctacgaggtagccctagagtacttgaatact
ggctga

DBGET integrated database retrieval system