KEGG   Bos indicus (zebu cattle): 109577782
Entry
109577782         CDS       T04792                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2 isoform X1
  KO
K02161  apoptosis regulator Bcl-2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu01524  Platinum drug resistance
biu04064  NF-kappa B signaling pathway
biu04066  HIF-1 signaling pathway
biu04071  Sphingolipid signaling pathway
biu04115  p53 signaling pathway
biu04140  Autophagy - animal
biu04141  Protein processing in endoplasmic reticulum
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04217  Necroptosis
biu04261  Adrenergic signaling in cardiomyocytes
biu04340  Hedgehog signaling pathway
biu04510  Focal adhesion
biu04621  NOD-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04722  Neurotrophin signaling pathway
biu04725  Cholinergic synapse
biu04915  Estrogen signaling pathway
biu04928  Parathyroid hormone synthesis, secretion and action
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05014  Amyotrophic lateral sclerosis
biu05132  Salmonella infection
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05161  Hepatitis B
biu05162  Measles
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05215  Prostate cancer
biu05222  Small cell lung cancer
biu05226  Gastric cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109577782 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    109577782 (BCL2)
   04630 JAK-STAT signaling pathway
    109577782 (BCL2)
   04064 NF-kappa B signaling pathway
    109577782 (BCL2)
   04066 HIF-1 signaling pathway
    109577782 (BCL2)
   04071 Sphingolipid signaling pathway
    109577782 (BCL2)
   04151 PI3K-Akt signaling pathway
    109577782 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109577782 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    109577782 (BCL2)
   04215 Apoptosis - multiple species
    109577782 (BCL2)
   04217 Necroptosis
    109577782 (BCL2)
   04115 p53 signaling pathway
    109577782 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109577782 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109577782 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    109577782 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    109577782 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109577782 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    109577782 (BCL2)
   04722 Neurotrophin signaling pathway
    109577782 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109577782 (BCL2)
   05206 MicroRNAs in cancer
    109577782 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109577782 (BCL2)
   05226 Gastric cancer
    109577782 (BCL2)
   05215 Prostate cancer
    109577782 (BCL2)
   05222 Small cell lung cancer
    109577782 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109577782 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109577782 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109577782 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109577782 (BCL2)
   05152 Tuberculosis
    109577782 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109577782 (BCL2)
   05162 Measles
    109577782 (BCL2)
   05161 Hepatitis B
    109577782 (BCL2)
   05168 Herpes simplex virus 1 infection
    109577782 (BCL2)
   05169 Epstein-Barr virus infection
    109577782 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109577782 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109577782 (BCL2)
   01524 Platinum drug resistance
    109577782 (BCL2)
   01522 Endocrine resistance
    109577782 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109577782 (BCL2)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109577782 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 109577782
NCBI-ProteinID: XP_019842178
Position
24
AA seq 229 aa
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPS
RTSPXXXXAAAAGPAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRF
ATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHTWIQ
DNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
NT seq 690 nt   +upstreamnt  +downstreamnt
atggcgcacgcggggggaacaggctacgataaccgagagatcgtgatgaagtacatccac
tataagctgtcgcagcggggctacgagtgggatgccggagacgcgggcgccgcgcccccc
ggggccgctcccgcgccgggcatcctgtcctcccagccgggccgcacacccgcgccctcc
aggacctccccnnnnnnnnnnnnggccgccgccgccgggcctgcgcccagcccggtgccg
cctgtggtgcacctgaccctgcgccaggccggcgatgacttctctcggcgctaccgccgc
gacttcgccgagatgtccagtcagctgcacctgacgcccttcaccgcgaggggacgcttc
gccacggtggtggaggagctcttcagggacggggtgaactgggggcgcatcgtggccttc
tttgagttcggaggggtcatgtgtgtggagagcgtcaaccgggagatgtcgcccctggtg
gacagcatcgccctgtggatgaccgagtacctgaaccggcacctgcacacctggatccag
gacaacggaggctgggacgcctttgtggagctgtatggccctagcatgcggcccctgttt
gatttctcctggctgtctctgaaggcactgctcagtctggccctggtgggcgcttgcatc
accctgggtgcctatctgggccataagtga

DBGET integrated database retrieval system