KEGG   Bos indicus (zebu cattle): 109577925
Entry
109577925         CDS       T04792                                 

Gene name
CDH2
Definition
(RefSeq) cadherin-2
  KO
K06736  cadherin 2, type 1, N-cadherin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577925 (CDH2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109577925 (CDH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:biu03036]
    109577925 (CDH2)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109577925 (CDH2)
   04090 CD molecules [BR:biu04090]
    109577925 (CDH2)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    109577925 (CDH2)
Cell adhesion molecules [BR:biu04515]
 Cadherins
  Major cadherins
   109577925 (CDH2)
CD molecules [BR:biu04090]
 Proteins
  109577925 (CDH2)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_3 EphA2_TM DUF4381 Stevor
Other DBs
NCBI-GeneID: 109577925
NCBI-ProteinID: XP_019842469
Position
24
AA seq 906 aa
MCRIVGAPRTLLPLLAALLQASVXASGEISLCKTGFPEDVYSAVLSRDVLEGQPLLNVKF
SNCNGKRKVQYESSEPADFKVDEDGMVYAVRSFPLSSEHSKFLIYAQDKETQEKWQVAVK
LSLKPALPEDSVKESREIEEIVFPRQVTKHNGYLQRQKRDWVIPPINLPENSRGPFPQEL
VRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAV
DINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNAL
NGMLRYRILSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTY
GLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDVIVANLTVTDKDQPHTPAWNAIY
RISGGDPAGRFAIQTDPNSNDGLVTVVKPIDFETNRMYVLTVAAENQVPLAKGIQHPPQS
TATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTVLTTFTAQDPDRYMQQNIRYTKLSDP
ANWLKIDSVNGQITTIAVLDRESPNVKANIYNATFLASDNGIPPMSGTGTLQIYLLDIND
NAPQVLPQEAEICETPDPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTITRLNGD
FAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGL
GTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGE
EDQDYDLSQLQQPDTVEPDAIKPVGIRRLDERPIHAEPQYPVRSAAPHPGDIGDFINEGL
KAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADM
YGGGDD
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgtgccggatagtgggagcgccgcggaccctgctgccgctgctggcggccctgcttcag
gcttccgtggakgcttctggggagatttcgttatgcaagactggatttcctgaagatgtg
tacagtgcagtcttgtcccgggatgtgctggaaggacagccccttctcaatgtgaagttt
agcaactgcaatgggaaaagaaaagtacagtatgagagcagcgagccagcagattttaag
gtggatgaagatggcatggtgtatgccgtgagaagcttccccctctcatctgaacactcg
aagttcctgatatacgctcaagacaaagagactcaggaaaagtggcaagtagcagtaaaa
ctgagcctcaaaccagccctacctgaggattcagtgaaggaatcacgagaaatagaagaa
atagtgtttccaagacaagtgactaagcacaatggctacctgcagaggcagaagagagac
tgggttatccctcccatcaacttgccagaaaactccagagggccttttcctcaagagctc
gtcaggatcagatccgatagagataaaaacctttctctgcggtacagcgtaactgggcca
ggagctgaccagcctccaactggtatcttcattatcaaccccatctcaggtcagctgtca
gtaaccaagcctctggatcgtgagctgatagcccggtttcatttgagggcacatgcagtg
gatattaatggaaaccaagtggagaaccccatcgacattgtcatcaacgttattgacatg
aatgataacagacctgagttcttacaccaggtttggaatgggacagttcctgagggatca
aagccgggaacatatgtgatgacggtcactgcgattgatgctgacgatccaaatgccctc
aatgggatgttgaggtacagaatcctgtcccaggcgccaagcaccccttcgcccaacatg
tttacaatcaacaatgagactggggacattatcacggtggcagctggacttgacagagaa
aaagtacaacagtatacgttaataattcaagctacagacatggaaggcaatcccacatat
ggcctttccaacacagccacggctgtcatcacggtgacagatgtcaacgacaatcctccg
gagtttactgccatgacgttctatggtgaagtccctgaaaacagggtagatgtcatcgtc
gctaatctaacagtgacagataaggatcagccccacacaccggcctggaacgccatctac
agaatcagcggtggagaccccgccggccgctttgccattcaaactgaccccaacagcaac
gacggtttagtcaccgtagtaaaaccaatcgactttgaaacaaataggatgtatgtcctt
actgtcgctgcagaaaatcaagtgccattagccaagggtattcagcatccacctcagtca
actgcgactgtgtctgtcacagttatcgatgtgaatgaaaatccttattttgccccaaat
ccaaagatcattcgccaagaagaaggccttcacgccggtaccgtgttaacaacgtttact
gctcaggacccagatcgatatatgcagcaaaatatcagatacaccaaattatccgatcct
gcaaactggctaaaaatagactctgtgaatgggcagataactaccattgctgttttggac
agagaatcaccgaatgtgaaagccaatatatacaatgctactttccttgcttctgacaat
ggaatccctcctatgagtggaacgggaacactgcagatctatttacttgatattaatgac
aatgcccctcaagtgttacctcaagaggcagagatttgtgaaactccggaccccaattca
attaacatcacagcacttgattatgacattgatccaaatgctggaccatttgcttttgat
cttcctttgtctccagtgactattaagagaaattggaccatcactcggcttaatggtgat
tttgctcagcttaacttaaagataaaatttcttgaggccgggatctacgaagttccaatc
ataatcacagattcgggtaatcctcccaaatcgaatatctccatccttcgggtgaaggtt
tgccagtgtgattccaacggggactgcacagatgtggatcgaattgtgggagcagggctg
ggcaccggcgccatcatcgccatcctgctttgcatcatcatcctgctcattctcgttctg
atgttcgtggtatggatgaaacgccgggataaagaacgccaggccaaacaacttttaatt
gatccagaagatgatgtaagagataatattttaaaatatgatgaagaaggtggaggagaa
gaagaccaggactacgatttgagccagctccagcagcctgatacggtagagccagatgcc
atcaagccagttggaatccgacggttggatgagaggcccatccatgcggagccccagtac
ccggttcgatctgcagccccacacccaggggacatcggggacttcattaatgagggcctt
aaagctgctgacaacgatcccaccgctccgccctacgactccctcttagtctttgactat
gaaggcagtggctccacrgccgggtccttgagctcccttaattcctccagtagtggaggt
gagcaggactatgactatctgaacgactgggggccccgcttcaagaaactcgctgacatg
tacggtggaggtgatgactga

DBGET integrated database retrieval system