KEGG   Bos indicus (zebu cattle): 109577992
Entry
109577992         CDS       T04792                                 

Gene name
PMAIP1
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04115  p53 signaling pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109577992 (PMAIP1)
   04215 Apoptosis - multiple species
    109577992 (PMAIP1)
   04115 p53 signaling pathway
    109577992 (PMAIP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109577992 (PMAIP1)
   05203 Viral carcinogenesis
    109577992 (PMAIP1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109577992 (PMAIP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109577992 (PMAIP1)
SSDB
Motif
Pfam: PMAIP1 Bclx_interact
Other DBs
NCBI-GeneID: 109577992
NCBI-ProteinID: XP_019842549
Position
24
AA seq 54 aa
MPGRRARKSAQPSPXRVPADPEVECAIQLRRIGDKLNFRQKLVNLISKLLRSGT
NT seq 165 nt   +upstreamnt  +downstreamnt
atgcctggaaggagggctcgtaagagcgcccagccgagccccncgcgggtcccggcagat
cctgaagttgaatgtgccattcagttgaggagaattggagacaaactgaatttccggcag
aaacttgtgaatctgatatccaaactcctccgctcaggaacttga

DBGET integrated database retrieval system