KEGG   Bos indicus (zebu cattle): 109577994
Entry
109577994         CDS       T04792                                 

Gene name
CD226
Definition
(RefSeq) CD226 antigen
  KO
K06567  CD226 antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577994 (CD226)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109577994 (CD226)
CD molecules [BR:biu04090]
 Proteins
  109577994 (CD226)
SSDB
Motif
Pfam: V-set Ig_3 ig I-set Ig_2 Ig_6 Orthoreo_P10 DUF4293 DUF5385 PMP1_2 Vpu
Other DBs
NCBI-GeneID: 109577994
NCBI-ProteinID: XP_019842551
Position
24
AA seq 334 aa
MDHXTLLLAILYVYTAPCEEIFWDTTVKLAKNMTLECVYPLADTVTQMEWFKIKMERESM
AIFNPAFHGIIREAYTDRVYFSNHTMASNDMTLSFHNASEADXGFYSCLLHTFPHGTWEK
VIQVVPPDNFEDAGPPNSQMVSEPGKNITLTCEPRENHLLEEVSWEKIQPQQIDLLISCN
LSQGRNYTSKYPRQILSNCNKGMKKAFVTMPNVIGSDSGLYRCGFKASTGEKETFVMRLT
VTNGETKNSYIPFVAGGAVLLFLLVILITTITVITYKRKKRQQKRGLFKDVWITQNRATN
NYRNPFPPNPPAGGAGEDIYVNHPVFCLGXRARV
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggatcacytcaccctcctcttggcaattctttatgtgtacacagcgccatgtgaagag
attttytgggacacgactgttaaacttgctaagaatatgaccctagaatgtgtgtatcca
ttagcggacactgtaacccagatggagtggttcaagattaagatggagagagagtccatg
gccattttcaaccctgcattccatgggatcataagagaggcctacactgatagggtctac
ttctcaaatcacaccatggcctctaacgacatgaccctgtccttccacaatgcctctgag
gcggacktgggcttctattcctgcctcctgcatactttcccacacggaacctgggagaag
gtgatacaggtggtcccaccagacaattttgaggatgctgggccaccaaatagccagatg
gtctcagaacctggaaaaaacatcacgctcacctgtgagcctcgagagaaccatctgtta
gaagaagtgtcatgggaaaagatccagccccagcagattgacctcttaataagctgcaac
ttgtcccaaggaagaaattacacgtccaagtacccaagacagatactgagcaactgcaac
aagggcatgaaaaaggcctttgtcaccatgcctaatgttataggctctgactcaggactc
taccgctgtggcttcaaagccagcactggggaaaaagaaaccttcgtgatgagattgacc
gtaaccaatggtgaaaccaagaactcatacatcccctttgtggctggtggggcagttctt
ctgttcctattggttatcctaattaccaccatcactgtcattacttacaagagaaagaaa
aggcaacagaaaagaggcctatttaaagacgtctggatcacacagaatagggcaaccaac
aactacagaaatcccttccctcccaatccaccggcaggtggtgcaggagaggacatttat
gtcaaccacccggtcttctgtcttggacmaagggctagagtctaa

DBGET integrated database retrieval system