KEGG   Bos indicus (zebu cattle): 109578066
Entry
109578066         CDS       T04792                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu03320  PPAR signaling pathway
biu04068  FoxO signaling pathway
biu04071  Sphingolipid signaling pathway
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04210  Apoptosis
biu04510  Focal adhesion
biu04660  T cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04722  Neurotrophin signaling pathway
biu04910  Insulin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04931  Insulin resistance
biu04960  Aldosterone-regulated sodium reabsorption
biu05145  Toxoplasmosis
biu05205  Proteoglycans in cancer
biu05213  Endometrial cancer
biu05215  Prostate cancer
biu05223  Non-small cell lung cancer
biu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109578066 (PDPK1)
   04071 Sphingolipid signaling pathway
    109578066 (PDPK1)
   04151 PI3K-Akt signaling pathway
    109578066 (PDPK1)
   04152 AMPK signaling pathway
    109578066 (PDPK1)
   04150 mTOR signaling pathway
    109578066 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109578066 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    109578066 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109578066 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    109578066 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    109578066 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109578066 (PDPK1)
   03320 PPAR signaling pathway
    109578066 (PDPK1)
   04919 Thyroid hormone signaling pathway
    109578066 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109578066 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109578066 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109578066 (PDPK1)
   05231 Choline metabolism in cancer
    109578066 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    109578066 (PDPK1)
   05213 Endometrial cancer
    109578066 (PDPK1)
   05223 Non-small cell lung cancer
    109578066 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109578066 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109578066 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109578066 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109578066 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109578066 (PDPK1)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109578066 (PDPK1)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   109578066 (PDPK1)
Membrane trafficking [BR:biu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    109578066 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Pkinase_fungal APH Kinase-like Kdo
Other DBs
NCBI-GeneID: 109578066
NCBI-ProteinID: XP_019842613
Position
25
AA seq 644 aa
MRADARGLLPAPPPXPPRGWPLLSVLSLAWAETRYDTVPIQSSVVLCSCPSPSMVRTQTE
SSTAPGVPSGGSRQGPAMDGTAAQPRASASALQHAAQPPQPRKKRPEDFKFGKILGEGSF
STVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDE
KLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEMVSALEYLHGKGIVHRDLKPENILL
NEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKRSAGRAQQALQE
PGPVVATGWRTQAEASVPSELTRAHTASVCARGLHGRLPGATSRCQRQNQLFSDRGGSLR
EREPAGRLFLFYRNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEG
YGPLKAHPFFESISWEDLHHQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSASS
SSHSLSAVDTGLPQRVGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQASGNPWHQFV
ENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFK
TFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRHRYQSHPDAAVQ
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgcgtgcggacgcccggggcctgctgcctgcgccgcctccascgccacctcggggatgg
cctctgctctctgtgctgtccctcgcctgggctgagacccgttatgacacggttcccatt
cagtccagcgtggtgttatgctcctgcccatccccatcaatggtgaggacccagactgag
tccagcacggcccccggcgttcccagcggggggagcaggcagggccccgccatggacggc
accgcggcccagccccgggcgagcgccagcgctctgcagcacgccgcgcagcccccgcag
cctcggaagaaacggcccgaggacttcaaattcgggaagattctcggtgaaggctcgttt
tcaacagttgtcctggcccgagaactggcaacctcaagggaatatgctattaaaattcta
gagaaacgccacattatcaaagagaacaaagtcccgtatgtaaccagagagcgagacgtg
atgtcgcggctggatcatcccttctttgttaaactttacttcacgtttcaggatgatgaa
aaactgtattttggccttagttatgccaaaaatggagaactacttaaatacattcggaaa
attggttcattcgatgagacgtgcacccgcttttacacggccgagatggtgtccgccctg
gagtacttgcacggcaagggcatcgtccacagggacctgaaaccagaaaatattttgtta
aatgaagacatgcacatccagatcacagattttggaacagcgaaagtattatccccagag
agtaaacaagccagggccaactcgtttgtgggaacagcccagtatgtctctccagagctg
ctcacagagaaatcggcctgtaagaggagtgcagggcgggcccagcaggccctccaggag
ccaggcccggtggtggccacaggctggaggacccaggcagaggcctcagtgccatcggag
ctgaccagggcccacacggccagtgtctgcgcccgtgggctgcacggccgccttcctggc
gcaacaagccgctgccagaggcagaaccagctcttcagtgaccgcggtggctctctgcgg
gagagggagccggctggacggcttttcttgttttacagaaatgagtatcttatatttcag
aagatcattaagttggagtatgactttcctgaaaaattctttcctaaggcgagagatctt
gtggaaaaacttctggttttagatgccacaaagcgattaggctgtgaagaaatggagggg
tatggccctctgaaagcccacccgttctttgagtccatctcgtgggaggacctgcatcac
cagacgcccccaaagctcacggcttacttgccggccatgtcggaagacgacgaggactgc
tatggcaactacgacaatctcctgagccagttcggctgcatgcaggtgtccgcgtcctcc
tcctcgcactccctgtcggccgtggacacgggtctgccccagcgggtgggcagcaacatc
gagcagtacatccacgacctggacacgaactcctttgaactggacttacagttttctgaa
gacgagaagaggttgttgttggagaagcaggcaagcggaaacccttggcaccagtttgta
gaaaataatttaatactaaaaatgggtccagtagacaagcggaagggtttatttgcacgg
cgacgacagctgctgctcacggaagggccacacttgtattacgtggatcctgtcaacaaa
gtcttgaaaggtgaaattccatggtcacaagaactccgaccagaggccaagaattttaaa
accttctttgtgcacacgccaaacaggacatattacctgatggaccccagcgggaacgcg
cataagtggtgccgaaagatccaggaggtgtggcggcacaggtaccagagccacccggat
gctgccgtgcagtga

DBGET integrated database retrieval system