KEGG   Bos indicus (zebu cattle): 109578145
Entry
109578145         CDS       T04792                                 

Gene name
ITGAL
Definition
(RefSeq) integrin alpha-L
  KO
K05718  integrin alpha L
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04015  Rap1 signaling pathway
biu04514  Cell adhesion molecules
biu04650  Natural killer cell mediated cytotoxicity
biu04670  Leukocyte transendothelial migration
biu04810  Regulation of actin cytoskeleton
biu05144  Malaria
biu05150  Staphylococcus aureus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05169  Epstein-Barr virus infection
biu05323  Rheumatoid arthritis
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109578145 (ITGAL)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109578145 (ITGAL)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109578145 (ITGAL)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109578145 (ITGAL)
   04670 Leukocyte transendothelial migration
    109578145 (ITGAL)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    109578145 (ITGAL)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109578145 (ITGAL)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109578145 (ITGAL)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109578145 (ITGAL)
   05169 Epstein-Barr virus infection
    109578145 (ITGAL)
  09174 Infectious disease: parasitic
   05144 Malaria
    109578145 (ITGAL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109578145 (ITGAL)
   04515 Cell adhesion molecules [BR:biu04515]
    109578145 (ITGAL)
   04090 CD molecules [BR:biu04090]
    109578145 (ITGAL)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109578145 (ITGAL)
Cell adhesion molecules [BR:biu04515]
 Integrins
  Integrin alpha subunits
   109578145 (ITGAL)
CD molecules [BR:biu04090]
 Proteins
  109578145 (ITGAL)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS Integrin_alpha HisK_sensor FG-GAP_2
Other DBs
NCBI-GeneID: 109578145
NCBI-ProteinID: XP_019842704
Position
25
AA seq 1221 aa
MNSCIIVLRLLLSGPFVFAPAWSYNLDVRHVQNFSFPLAGRHFGYRVLQVGNGVVVGAPS
EGNSMGNLYQCQPETGDCLPVTLSSNYTSKYLGMTLATDPTSDNLLACDPGLSRTCDQNI
YLSGLCYLIHENLRGPVLQGHPGYQECIKGNVDLVFLFDGSMSLQQDEFEKIVDFMKDVM
KKLSNSSYQFAAVQFSTYFRTEFTFLDYIRQKDPDALLAGVKHMRLLTNTFGAINYVAKE
VFRPDLGARPDATKVLIIITDGEATDEHNIDAAKDIIRYIIGIGKNFKTKESQEALHQFA
SKPVEEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLSEGHG
VVGAVGAKDWAGGFLDLNPGVAQSRTRLKQLSSSSSQDLYPSEHMAALLRRRSSDDFRAS
FPLTQLPRIASTFSPGLYLLSAALVFLTPSPSLSLSSGYTVTWLPSRGTMSLLATGAPRY
QHVGRVLLFQQPKRGGPWSQIQEIDGIQIGSYFGGELCGVDVDRDGETELLLIAAPLYYG
EQRGGRVFIYQKIQLEFQMVSELQGETGYPLGRFGAAIAALTDINGDELTDVAVGAPLEE
QGAVYIFNGQQGGLSPRPSQRIEGTQMFSGIQWFGRSIHGVKDLGGDGLADVAVGAEGQV
IVLSSRPVVDIITSVSFSPAEIPVHEVECSYSTSNQKKEGVNLTVCFQVKSLISTFQGHL
VANLTYTLQLDGHRTRSRGLFPGGKHKLIGNTAVTPVKSCFVFWFHFPICIQDLISPINV
SLSYSLWEEEGTPRDPRALDRDIPPILKPSPHLETKEIPFEKNCGEDKNCEADLKLAFSD
MRSKILRLTPSASLSVRLTLRNTAEDAYWVQVTLSFPQGLSFRKVEILKPHSHVPVGCEE
LPEEAVVHSRALSCNVSSPIFGEDSMVDIQVMFNTLQKGSWGDFIELQANVSCNNEDSSL
LEDNSATTSIPVMYPINVLTKDQENSTLYISFTPKSPKIHHVKHIYQVRIQPSNYDNMPP
LEALVRVPRVHSEGLITHKWSIQMEPPVNCSPRNLESPSDEAESCSFGTEFRCPIDFRQE
ILVQVNGMVELRGTIKASSMLSLCSSLAISFNSSKHFHLYGRNASMAQVVMKVDLVYEKE
MLYLYVLSGIGGLLLLFLIFIALYKVGFFKRNLKEKMEANVDASSEIPGEDAGQPELEKE
CKDPGCLEPLQKTDEDGSGGD
NT seq 3666 nt   +upstreamnt  +downstreamnt
atgaattcctgcatcatcgtgctgaggttgctgctgtctggaccttttgtctttgcccca
gcctggagctacaacctggatgtgcgacatgtgcaaaacttctcctttccacttgccggg
aggcattttgggtaccgcgttctgcaagttggaaatggggttgtcgtgggagctccaagc
gaagggaacagcatgggaaacctgtatcaatgccagccagaaactggagactgcctgcca
gtcacactgagttccaactatacctccaagtacttgggaatgaccttggcaacagacccc
acaagtgacaacctgttggcctgtgatcctgggctgtctcgaacatgtgaccagaacatc
tatctaagtggtctgtgttacctcatccacgagaacctgaggggtccggtgctgcaaggg
caccctggttatcaggaatgtataaagggcaacgtagacttggtatttctgtttgatggc
tcaatgagcttgcagcaagatgaatttgagaaaattgtggacttcatgaaggatgtgatg
aagaaactcagcaactcttcctaccagtttgcggctgttcagttttctacatatttcaga
acagaatttactttcttggattacattagacagaaggaccctgacgctctgttggctgga
gtcaaacacatgcgtttgttgaccaacacctttggtgccatcaactatgttgcgaaagaa
gtgttccggccagacctgggagcccgcccagatgccaccaaagtgcttatcatcatcact
gatggggaagccaccgacgaacacaacattgatgcggccaaagacatcatccgctacatc
attgggattggaaaaaattttaagaccaaagaaagtcaggaggcgctccatcagtttgcc
tccaaacccgtggaggagtttgtaaagatcctggacacgtttgagaagctgaaagatcta
ttcaccgagctgcaaaaaaagatctatgtcattgagggcacaagcaaacaggacctgaca
tccttcaacatggagctgtcctccagcgggatcagcgcggacctcagcgagggccatggc
gttgtgggggccgttggagccaaggactgggctgggggctttctcgacctcaaccctggg
gtcgcacagagtcggacacgactgaagcaacttagcagcagcagcagccaggatttgtac
ccctcggagcacatggctgctcttctcaggagaaggtcttctgatgatttccgtgcatct
ttcccgctaacccagcttcccaggatcgcctccaccttttcccctgggctttaccttctt
tcagcagcccttgtgttcctgactccaagcccctccctctctctctcctcaggttacacg
gtgacctggctgccctcccgagggaccatgtcattgctggccactggagcccccagatac
cagcatgtcgggcgggtgctgctgttccaacagccaaagagaggaggaccctggagccag
atccaggaaatagatgggatccagattggctcttattttggtggcgagttgtgtggcgtt
gacgtggacagagatggggagacggagctgttgctgattgcagcccccctgtactatggg
gagcagagaggaggccgggtgtttatctaccagaaaatacagctggagttccaaatggtc
tcagagctgcagggggagaccggctacccccttgggcgatttggagctgccatcgctgcc
ctgacagacatcaacggggatgagctgacagacgtggctgtgggagcccctctggaggag
cagggggccgtgtacatcttcaatgggcaacaaggggggctgagcccccggcccagtcag
cggatagaagggacccagatgttctcaggaattcaatggtttggacgctccatccacggg
gtgaaggacctcggcggggatggcctggcagatgtggctgtgggggctgagggccaggtg
atcgtgctcagctcccggcctgtggtggacatcatcacaagcgtgtccttctccccggcc
gagatcccagtgcatgaagtcgagtgctcctattccaccagcaaccagaagaaggaaggc
gttaacctcacagtctgtttccaggtcaagtctctcatctccaccttccaagggcacctg
gttgccaacctcacttacactctgcagctggayggccatcggacccgaagccggggcttg
ttcccaggagggaaacacaaactcatcgggaacacagctgtcacccctgtcaagtcctgc
tttgtgttctggttccacttcccgatatgcattcaagatctcatctctcccatcaacgtc
tccctaagttactctctctgggaggaagaagggacaccgagggacccaagggcgctggac
agggacatcccgcccatcctgaaaccctcaccacacttggagaccaaggagattcctttt
gagaagaactgcggagaggacaagaattgtgaggcagacctgaagctggccttctccgac
atgagatccaaaatcctgcgtctgaccccctctgccagcctctctgtgaggctgacactg
aggaacacagcagaagatgcttactgggtccaggtcaccctgagcttcccccagggactc
tcattccgcaaagtggagatcctcaagccccacagccatgtacctgtgggctgcgaggag
ctccctgaggaggccgtagtgcacagcagggccctctcctgcaatgtgagctctcccatc
ttcggagaagacagcatggttgatatccaggtgatgtttaatacgctgcagaaaggctcc
tggggggattttatcgagctgcaggccaatgtgagctgcaacaatgaggactcaagcctc
ctggaggacaactcggccaccaccagcatccctgtcatgtaccccatcaacgtcctcacc
aaggaccaggaaaactccacgctgtatatcagtttcacccccaagagtcccaagatccac
catgtcaagcacatttaccaggtgaggatccagccttctaactatgacaacatgccccca
ctggaggccttggttagggtaccacgggtgcacagcgaggggctcatcacccacaagtgg
agcatacagatggagcctccagtcaactgcagccccagaaatctggagagtccatctgat
gaggctgagtcttgctcgtttggaaccgagttccgctgcccaattgacttcagacaggag
atccttgtccaagtgaacgggatggtggagttgagggggacgatcaaggcctcctccatg
ttgagcctctgtagctccctcgccatctccttcaacagcagcaagcattttcacctctat
ggcaggaacgcctccatggcccaggtcgtcatgaaggttgaccttgtatatgagaaagag
atgctctatctctacgtgctgagcggaatcggggggctgttgttgctgttcctgattttc
atagctctgtacaaggttggtttcttcaaacggaacctgaaggagaagatggaggcgaac
gtagatgcttccagtgaaatccctggagaagatgctgggcagccggagttggagaaagag
tgcaaggacccaggctgcctggagcccctccagaagacggatgaggacggaagtggtgga
gattga

DBGET integrated database retrieval system