KEGG   Bos indicus (zebu cattle): 109578437
Entry
109578437         CDS       T04792                                 

Gene name
F11R
Definition
(RefSeq) junctional adhesion molecule A isoform X1
  KO
K06089  junctional adhesion molecule 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109578437 (F11R)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109578437 (F11R)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109578437 (F11R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109578437 (F11R)
CD molecules [BR:biu04090]
 Proteins
  109578437 (F11R)
SSDB
Motif
Pfam: Ig_3 ig I-set Ig_2 V-set C2-set_2 Ig_6 C1-set Adeno_E3_CR1 Ig_C17orf99 Big_3
Other DBs
NCBI-GeneID: 109578437
NCBI-ProteinID: XP_019843192
Position
3
AA seq 298 aa
MGTKAKVGSTELLLFTSMILCSLALGRGAVQTYEPVVRVPENNPAKLSCSYSGFSSPRVE
WKFTHGDIRGLVCYNNKITASYENRVTFSDTGITFHSVTRKDTGMYTCMVSDEGGNTYGE
VTVQLIVLVPPSKPTINVPSSVTIGTRAVLTCSERDGSPPSEYKWFKDGVEMPLEPKSNR
AFSNSSYTLNQKTGELIFDPVSASDTGDFTCQAQNGYASPVKSDTVHMDAVELNVGGIVA
AVFVTLILLGALIFGIWFAYSRGYFDRAKKGTSNKKVIYSQPNARSDGEFRQTSSFLV
NT seq 897 nt   +upstreamnt  +downstreamnt
atgggtacaaaggcgaaagtcggcagtacagagttgcttctcttcacgtcgatgatcctg
tgctccctggcattgggcaggggtgcggtgcaaacctatgaaccggtagtcagagttcct
gagaataaccctgccaagctgtcctgctcctactcgggcttctcctcgccacgtgtggag
tggaagtttacccatggtgatatcagaggtctcgtttgctataacaacaaaatcactgct
tcctatgagaaccgagtgaccttctcggatactggcatcaccttccattctgtgacccgg
aaagacacggggatgtatacttgtatggtctctgatgagggcggcaatacctacggggag
gtcaccgtccagctcatcgtgctcgtgcctccatccaagcctacaatcaacgtcccctcc
tctgttaccattggaacccgagctgtgctgacctgctcagagagagatggctccccgcca
tctgaatacaagtggttcaaggatggtgtagagatgcctctggaacccaagagcaaccgt
gccttcagcaactcttcctacaccctgaaccagaagacaggggagttgatctttgatccc
gtgtcggcctctgacactggagatttcacctgtcaggcacagaatggctatgcgtccccc
gtgaagtcagacaccgtgcacatggatgctgtggagctcaatgttgggggcatcgtggca
gctgtctttgtaacactcattctcctgggagccttgatttttggcatctggttcgcctat
agccgaggctactttgacagagcaaagaaagggacctccaataagaaggtaatttacagc
cagcccaatgctcgaagtgacggggagttcagacagacctcgtcattcttggtgtga

DBGET integrated database retrieval system