KEGG   Bos indicus (zebu cattle): 109578803
Entry
109578803         CDS       T04792                                 

Gene name
SPN
Definition
(RefSeq) leukosialin
  KO
K06477  sialophorin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109578803 (SPN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109578803 (SPN)
CD molecules [BR:biu04090]
 Proteins
  109578803 (SPN)
SSDB
Motif
Pfam: SP_C-Propep
Other DBs
NCBI-GeneID: 109578803
NCBI-ProteinID: XP_019843874
Position
25
AA seq 492 aa
MILLLLLFGSMGAENVTEVSSRSSPLWTSKTTIASLSSVSETLTFNSVTTSLTTNEVSKM
SDNPEHQTLPPSSIPYIADVVSSPETSPTASRGSPVSESTISKEDSSKKXIKLMKTPDAT
STPGVSVMKPTGFPTMTSKTMATSPLETSSATSKVLLTMATSSLEISGGTSRPPVSMAMS
SLDTSSGTSEVLLTMATSSLDISGGTSRPPVSMATSSLDTSSGTSEVLLTMATSSLDISG
GTSRPPVTMATSSLETSSGTREPLVTTATSSVKTISMTSGSPVIMKTSSPKTSKGSGLLV
TTPATSLKTPMGTTGSTGHEVTTFSPNTSTXVSRRDKLIPPQGTKGTLLVAVLVALLVVV
VLVALILLWLRRQKRKTGVLTLGGGGKRNGVVDAWAGVARVPDEEAMTATEGASRGNNDS
DGPHREGSGQRPTLTTFFGRRKSRQGSMALEELKAGPASSLTGEEEPLVCNEDEGAEAPT
SNGPEAREVKTP
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgatcctgcttctcctcctcttcgggagcatgggggcagaaaacgtgactgaagtgtct
tcaagaagctctcctttgtggacatctaaaaccacaatagcctctctttcttcggtctct
gagaccctaactttcaactcagtgacaaccagtcttacaacaaacgaggtctctaagatg
agtgataaccctgagcaccagaccttaccgccttcctcgattccctatatagccgatgtg
gtgtcctctcctgaaacttcccccactgccagcaggggcagtcctgtatctgagtcaaca
atctccaaggaagattcaagcaagaaaycaataaagctcatgaaaacccctgatgccacc
agcacacctggtgtctcagtaatgaaacctacaggattccctactatgactagcaaaacc
atggcaactagccctctggagacctccagtgcgaccagcaaagtcctattaactatggca
actagctctctggagatctctggtgggaccagtagacctcctgtctccatggcaatgagc
tctttggacacctccagtgggaccagcgaagtcctgttaactatggcaactagctctctg
gatatctctggtgggaccagtagacctcctgtctccatggcaacgagctctctggacacc
tccagtgggaccagcgaagtcctgttaactatggcaactagctctctggatatctctggt
gggaccagtagacctcctgtcaccatggcaacaagctctctggagacctccagtgggacc
agggaaccccttgtcaccacggcaactagctctgtgaagaccatcagtatgaccagtgga
tcccctgtcatcatgaaaactagctctcctaagacctccaagggaagtggactcctggtc
accacgccagctacctctctcaagactcccatggggaccactggctccactggccatgaa
gtaacaacattcagccccaatacctccacawacgtaagcaggagggacaaactaattcca
cctcaggggacaaaaggcaccttgctggtggctgtgcttgtggccctgctggtggtcgtt
gtcctcgtggccttaatcctgttgtggctccggcgacagaagcggaagacaggagtcctg
acactgggcggcggtgggaaacgcaatggggtggtagatgcctgggctggggtcgcccgg
gtgcctgatgaggaggccatgacagccacagagggagcgtctcgggggaacaacgactct
gatggcccccacagggaggggtctggccagcgacccacactcaccactttctttggtaga
cggaagtctcgccagggctccatggcgctggaggagctaaaggcagggccagcctccagc
ttaacgggggaagaggagccgctggtgtgcaacgaggatgaaggtgcagaggcccctact
tctaatgggccagaagcgagagaggtgaagaccccttaa

DBGET integrated database retrieval system