KEGG   Bos indicus (zebu cattle): 109579171
Entry
109579171         CDS       T04792                                 

Gene name
FAS
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04010  MAPK signaling pathway
biu04060  Cytokine-cytokine receptor interaction
biu04115  p53 signaling pathway
biu04210  Apoptosis
biu04217  Necroptosis
biu04650  Natural killer cell mediated cytotoxicity
biu04668  TNF signaling pathway
biu04932  Non-alcoholic fatty liver disease
biu04940  Type I diabetes mellitus
biu05010  Alzheimer disease
biu05142  Chagas disease
biu05143  African trypanosomiasis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05320  Autoimmune thyroid disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109579171 (FAS)
   04668 TNF signaling pathway
    109579171 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109579171 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109579171 (FAS)
   04217 Necroptosis
    109579171 (FAS)
   04115 p53 signaling pathway
    109579171 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109579171 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109579171 (FAS)
   05205 Proteoglycans in cancer
    109579171 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109579171 (FAS)
   05330 Allograft rejection
    109579171 (FAS)
   05332 Graft-versus-host disease
    109579171 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109579171 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109579171 (FAS)
   04932 Non-alcoholic fatty liver disease
    109579171 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109579171 (FAS)
   05162 Measles
    109579171 (FAS)
   05164 Influenza A
    109579171 (FAS)
   05161 Hepatitis B
    109579171 (FAS)
   05160 Hepatitis C
    109579171 (FAS)
   05168 Herpes simplex virus 1 infection
    109579171 (FAS)
   05163 Human cytomegalovirus infection
    109579171 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109579171 (FAS)
   05169 Epstein-Barr virus infection
    109579171 (FAS)
   05165 Human papillomavirus infection
    109579171 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109579171 (FAS)
   05143 African trypanosomiasis
    109579171 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109579171 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109579171 (FAS)
   04090 CD molecules [BR:biu04090]
    109579171 (FAS)
Cytokine receptors [BR:biu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109579171 (FAS)
CD molecules [BR:biu04090]
 Proteins
  109579171 (FAS)
SSDB
Motif
Pfam: TNFR_c6 Death Stn1_C
Other DBs
NCBI-GeneID: 109579171
NCBI-ProteinID: XP_019844283
Position
26
AA seq 323 aa
MSGIWVHLSLIFISVSGPLSKGENAHMAGINSEGLKLNITEANSCQEGLYREHQFCCQPC
PPGKRKNGDCKRDGDTPECVLCSEGNEYTDKSHHSDKCIRCSICDEEHGLEVEQNCTRTR
NTKCRCKSNFFCNSSPCEHCNPCTTCEHGIIEKCTPTSNTKCKGSRSHANSLWALLILLI
PIVLIIYKVAKSRERNKKNDYCNSAASNDEGRQLNLTDVDLGKYIPSIAEQMRITEVKEF
VRKNGMEEAKIDDIMHDNVHETAEQKVQLLRNWYQSHGKKNAYCTLTKSLPKALAEKICD
IVMKDITNERENANLQNENENLV
NT seq 972 nt   +upstreamnt  +downstreamnt
atgtccgggatctgggttcacttgtcactgatatttatctctgtttctggaccattgtct
aaaggtgaaaatgcccacatggctggtatcaactctgaggggctgaaattgaatattact
gaagcgaactcctgccaagaaggcctgtatcgtgagcaccagttttgttgtcagccttgt
cctcctggcaaacggaaaaacggtgattgcaaacgcgacggagatacaccagaatgtgtg
ctctgctcagaggggaacgagtacacagacaagagccatcattctgacaaatgcataaga
tgtagtatctgtgatgaagaacatgggctagaagtggaacaaaactgtactcggacccgg
aataccaagtgcagatgcaaatcgaactttttttgtaacagttctccgtgtgaacactgt
aacccttgcaccacgtgtgaacatggaatcattgagaaatgcacaccaacgagcaacacc
aaatgcaaaggatccagatctcacgcaaacagtttatgggccctcctgatcctcctcatc
ccaatagttctaataatatacaaagtggcgaaaagtcgagagaggaataaaaaaaatgat
tattgcaactctgcagcctcaaatgatgaagggaggcaactgaatttaacagatgttgac
ttgggtaaatatatccctagtattgctgaacaaatgagaataactgaagttaaagagttt
gttcggaagaacggtatggaggaagccaaaatagatgatatcatgcatgacaatgtccat
gaaacagctgaacagaaggtccaactgctccgcaattggtatcaaagtcatgggaagaaa
aatgcatattgcactttgactaaaagtctcccaaaagctcttgcagagaaaatttgtgac
atagtcatgaaggacattactaatgaacgtgaaaatgcaaacttgcaaaatgaaaatgaa
aacttggtttaa

DBGET integrated database retrieval system