KEGG   Bradyrhizobium diazoefficiens USDA 110: bll0673Help
Entry
bll0673           CDS       T00109                                 

Definition
(RefSeq) deoxyribonucleotide triphosphate pyrophosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    bll0673
Enzymes [BR:bja01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     bll0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-GeneID: 1049315
NCBI-ProteinID: NP_767313
RhizoBase: bll0673
UniProt: Q89WK5
Position
complement(719282..719917)
Genome map
AA seq 211 aa AA seqDB search
MHRRITGKLVIATHNPGKLAEMKELLAPYGIEAVSAGELGLSEPDETGNDFRSNAAIKAI
AAAHASKLPSFADDSGIVVDALDGAPGIYSARWAGPTKDFTAAMTRIERLLQERGATAPD
KRKAHFVSALCVAWPDDHLEEVEARVDGTLVWPPRGTAGFGYDPMFRPDGHTRTFGEMTS
IEKHGLPPLGLALSHRARAFVKLAEICLEPR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgccgaatcaccggaaagctcgtcatcgccacccacaatcccggcaagctcgcc
gagatgaaggagcttttggcgccttacggcatcgaggcggtgtcggccggcgagctcggc
ctttccgagccggacgagaccggcaacgatttccgcagcaacgccgcgatcaaggctatc
gcggccgcgcacgcgtccaagcttccgtccttcgccgatgattccggcatcgtggtcgac
gcgctcgacggcgcgcccggcatctacagtgcgcgctgggccggaccgaccaaggatttc
accgcggcgatgacgcggatcgagcgcctgttgcaggagcgcggcgcgaccgcgcccgac
aagcgcaaggcgcacttcgtctccgcgctctgcgtcgcctggcccgacgatcatctcgaa
gaggtcgaggcgcgcgtcgacggcacgctggtctggccgccgcgcggcaccgccggcttc
ggctatgatccgatgtttcggcccgacggtcacacgcgcaccttcggcgagatgaccagc
atcgagaagcacggcctgccgccgctcggccttgccctgtcgcaccgtgcccgcgccttc
gtgaaactggcggagatctgccttgagccgcgctaa

DBGET integrated database retrieval system