KEGG   Bradyrhizobium diazoefficiens USDA 110: bll0975Help
Entry
bll0975           CDS       T00109                                 

Definition
(RefSeq) acetyl-CoA synthetase
  KO
K09181  acetyltransferase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 Succ_CoA_lig CoA_binding_2 CoA_binding ATP-grasp_2 AP_endonuc_2 AIRS GFO_IDH_MocA CPSase_L_D2
Motif
Other DBs
NCBI-GeneID: 1052176
NCBI-ProteinID: NP_767615
RhizoBase: bll0975
UniProt: Q89VS0
Position
complement(1069221..1071440)
Genome map
AA seq 739 aa AA seqDB search
MEARVSAAFSSPRPWSPSPDASDIVKGIHAMLHPHNIVLVGATDKPGNYAERIWNNLVKY
GFEGGLYPVNAKRETIWGVPCYKDFAALPEKPDHVLVLVPARFAVQVIRDAAAAGARSAT
IVTSGFSELQDDESQQLAAELQAAIRETGLAVTGPNCLGNLSAGEKLFTNIDDRIVTMEQ
GAVAIAGQSGAIVMAIRQALEDRGVGVGYMVTTGNEAGLETPDLMRYFAEDPSVKVIVVY
LEGVRNTKAFRDACKAARAASKPVIALKLGASEGGRAAAMAHTGALAGSIETFDAIATRE
GVIRVGGLDELIETTECFVHAAVPNGDRLAAVTLSGGKRGMLIDAFYAEGLNFAPLSPHV
SSELARMLGPGSIVGNPLDAGFAAVVDPSVYMKSIKLMIDDPDIDIVIIDAELPKAPHEL
RERNLRIVDEMASRASKPVIYISAMSIGFTEFTKSLRKSLPHLAVMQGMDRAVTAIKSLL
AYAKLRKEVPDIVSSSKPAARAVLEKALTSANGAALDEVASKKLLKAYGIPTSKEATAQT
AAEAVKIAKQIGFPVVAKVVSAEILHKSDIGGVVLNLSNAAEVKKAFADITARVKRLKGK
PRLDGILIAQQVKADLELVVGASLDAEMGPVVLFGTGGIDIELMKDVALAGAPLDEAEAR
LLIGRTKAGIKMRGYRGKPALHEASAVKALVGLSNLIADAGDRIASIDINPFLINTRTGV
AVDALIVLNNAAAKRAAGH
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggaagctcgcgtatctgctgcattctcctctccgcgcccatggtctccatcgcccgac
gccagcgacatcgtaaaaggcatccatgccatgctgcacccgcacaacatcgtgctggtg
ggcgcgaccgacaagcccggcaattatgccgagcgcatctggaacaatctggtcaaatac
ggcttcgagggcgggctctatccggtcaacgccaagcgcgagacgatctggggtgtgccc
tgctacaaggattttgcagccctcccggaaaagcccgatcatgtcctggtgctggtgccg
gcgcgtttcgccgtgcaggtgatccgcgatgccgccgcggccggcgcgcgctcggccacc
atcgtcacctccggcttcagcgagttgcaggatgacgagagccagcagctcgccgccgaa
ctgcaagcggccatccgcgaaaccggcctcgccgtcaccggcccgaattgcctcggcaac
ttgagcgccggcgaaaagctcttcaccaatatcgacgaccgcatcgtcaccatggagcag
ggcgcggtggcgatcgccgggcaatccggcgccatcgtcatggcgatccgccaggcgctg
gaggatcgcggtgtcggtgtcggctacatggtgacgaccggcaacgaggccgggctcgag
acgccggacctgatgcgttatttcgcggaggatccgagcgtcaaggtgatcgtggtctac
ctcgagggcgtgcgcaacacaaaggcctttcgcgacgcctgcaaggcggcgcgcgcggcg
agcaagcccgtgatcgcgctcaagctcggcgcatccgagggcggccgcgccgcggcgatg
gcgcacaccggagcgctggcgggctcgatcgagacgttcgacgcaatcgcaacgcgtgaa
ggtgttatccgggtcggcgggctcgacgaattgatcgagaccaccgaatgcttcgtccac
gccgccgtacccaacggtgaccggctcgccgcggtcacgctgtccggcggcaagcgcggc
atgctgatcgacgccttctatgcggaaggcttgaacttcgcaccgctcagcccgcatgtc
agctcggagctggcgaggatgcttgggcccggatcgatcgtaggcaatccgcttgacgcc
ggctttgccgcggtcgtcgatccctccgtctacatgaagtcgatcaagctgatgatcgac
gaccccgatatcgacatcgtcatcatcgatgccgagctgccgaaggcgccgcacgagctg
cgcgagcgtaacctgcgcatcgtcgacgagatggcgagccgggcctcaaagcccgtgatc
tacatcagcgcgatgtcgatcggcttcaccgagttcaccaagtccttgcgcaaatcgctg
ccgcatctcgcggtcatgcagggcatggatcgcgcggtcaccgcgatcaaatcactgctc
gcctatgcgaagctacgcaaggaagtacccgacatcgtctcgagctcgaaacccgccgcg
cgtgccgtgctggaaaaggcgctgacatcggcgaacggcgccgcgctcgacgaagtcgcc
tcgaagaagctcctgaaggcctatggcatcccgacctcgaaggaagcgaccgcacagacc
gcggcggaagccgtgaagatcgcgaaacagatcggcttcccggtcgtggcaaaggtcgtc
agcgccgagatcctgcacaagtccgacatcggcggcgtggtgctgaacctgagcaatgcg
gccgaggtgaagaaggcgttcgccgatatcaccgcgcgggtgaagcggctgaagggcaag
ccgaggctcgacggcatcctgatcgcgcagcaggtcaaggccgacctcgaactcgtggtc
ggcgcctcgctcgatgccgagatgggtccggtcgtgctgttcggcaccggcggcatcgac
atcgagctgatgaaggacgtcgcgctcgcgggcgcgccgctcgacgaggccgaggcgcgg
ctcctgatcggccgcaccaaggccggcatcaagatgcgcggctatcgcggcaagccggcc
ttgcacgaggcctccgcggtgaaggcgctggtcggcctgtccaacctgatcgcggatgcc
ggcgaccggatcgcctcgatcgacatcaatccgttcctgatcaacaccaggacgggcgtg
gcggtcgatgccctgatcgtgctgaacaatgccgcggcaaagcgcgcggccgggcattga

DBGET integrated database retrieval system