KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2241Help
Entry
bll2241           CDS       T00109                                 

Gene name
xynA
Definition
(RefSeq) endo-1,4-beta-xylanase
  KO
K01181  endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
Enzymes [BR:bja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     bll2241 (xynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_10 A-2_8-polyST
Motif
Other DBs
NCBI-GeneID: 1051728
NCBI-ProteinID: NP_768881
RhizoBase: bll2241
UniProt: Q89T09
Position
complement(2427995..2429062)
Genome map
AA seq 355 aa AA seqDB search
MARLDRREFLLGSAATLAAGASASALPASKLAQRRPGFGAAATLWDLQADPRLGEAISTY
CTQVVPVLELKWPMLRPDAHTFAFERADAILDFARANDLTMRGHALAWYHDIPDWTKQIK
DAKGVERAYLDHIGTVVSYYKEKLTSWDVVNEPIPDNPRSPKDRRDTFWTQHLGNNWIPL
AFRTAAAADPFVKLAINEYDIESAKDSFIAKRAAYRNLIMELLDQGVPLHAVGLQSHLHA
ELEIDTHGLAEFVTELRSWGLEVLVTELDVDDQKLTGNPAERDAIVAKRVDDLLTAISTS
GPVRSILTWGLSDRYSWINGTFARADKQPNRPLPLDGEFRPKPFMDVISRFTRDV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaggctcgacagacgcgaattccttctcggcagcgccgcgacgcttgcggcgggt
gcatccgcgtcagccttgccggcgtcgaaacttgcccagcgccgtccgggatttggtgca
gcggcaacgctctgggacctgcaggccgatccgcggcttggcgaagccatcagcacctat
tgcacgcaggtcgtgccggtgctcgagctgaaatggccgatgctgcgcccggacgcgcac
acgtttgccttcgagcgcgctgacgcgatcctggatttcgcgcgggcgaacgatctgacg
atgcgcgggcatgcgctggcctggtatcacgacattccagactggaccaagcagatcaag
gacgccaaaggcgtcgagcgtgcgtatctcgaccacatcggcaccgtcgtctcctactac
aaggagaagctgacgtcgtgggacgtcgtcaacgagccgatcccggacaatccccgcagt
ccgaaagaccggcgcgacacgttctggacgcagcatctcggcaacaactggatcccgctc
gccttccgcacggcggccgcggccgatcccttcgtcaagctcgcgatcaacgaatacgac
atcgagtcggccaaggactccttcatcgccaagcgcgctgcctaccgcaacctgatcatg
gagctgctcgaccaaggtgtcccgctgcacgccgtgggattgcagtcgcatctgcatgcc
gaactcgagatcgacacccatgggctcgccgaattcgtcaccgagctgcgctcgtggggg
ctggaagttctcgtcaccgagctcgacgtggacgatcagaagctgacgggcaacccggcc
gagcgcgacgccatcgtcgccaagcgtgtcgatgatctcctgaccgcgatctcgaccagc
ggcccggtgcgctcgatcctgacctggggcctctcggatcgctacagctggatcaacggc
accttcgcccgcgcggacaagcagccgaaccgtcccctgccgctcgacggcgaattcagg
ccgaagccgttcatggacgtcatcagcaggttcacgagggacgtttga

DBGET integrated database retrieval system