KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2504Help
Entry
bll2504           CDS       T00109                                 

Definition
(RefSeq) transcriptional regulator
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_1 LysR_substrate HTH_30
Motif
Other DBs
NCBI-GeneID: 1050375
NCBI-ProteinID: NP_769144
RhizoBase: bll2504
UniProt: Q89SA1
Position
complement(2730548..2731465)
Genome map
AA seq 305 aa AA seqDB search
MNLNSLDLNLLTALDALLREANVSRAAMRIGLSQPATSHALQRLRDIFGDPLLVRTGARM
ELTPRAQALRAPLAQALDQVRGLFVPDEFDAARSERQFRLMMPDLAVELLMPPLMEKVTR
AAPNVRVDVVPWRGPAIFHAEFARTIDLVISIGNAFKGFHRQLLYTDSDALAVRRGHPMG
AKLKRRETFLAARHVGVIIRGNSEDLIDTWLRAKGIERHIALVVSGYLEALHVAARTDLV
AFVPRRLIAALSRQLGLDTVTPPLDPGIDEQFMFYPTRAQMDSGSIWLRRLMLETGRELE
KRRAG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgaattcgcttgacctgaacctcttgaccgcactcgacgcgctgctgcgcgaa
gccaatgtcagccgcgcggccatgaggatcggcctgtcacagccggcgacgagccacgcg
ttgcaacgcctgcgcgacatcttcggcgacccgctgctggtgcgcaccggcgcgcgcatg
gagctgacgccgcgggcacaggccctgcgcgcgccgctggcacaggcgctcgatcaggtg
cgcgggctgttcgtgccggatgaattcgacgccgcgcgcagcgaacggcaattccgcctg
atgatgccggacctcgcggtcgagctgttgatgccgcccttgatggagaaagtgacgcgg
gccgcgcccaacgttcgcgtcgatgtcgtgccgtggcgggggcctgcgatcttccacgcc
gagttcgcccgcaccatcgacctcgtgatctcgatcggcaacgccttcaagggctttcac
cgccagctgctctacaccgacagcgacgcgctggcggtgcggcgcggccatcccatggga
gccaagctgaagcggcgcgagacgttcctcgccgcgcgccatgtcggcgtgatcatccgg
ggcaatagtgaggatctgatcgacacctggctgcgagccaagggcatcgagcggcacatt
gcactcgtcgtgtcaggctatctcgaagcgctgcacgtcgccgcccgcaccgaccttgtc
gccttcgtgccgcgccggctgatcgcggcgctgtcgaggcagctcggcctcgacaccgtg
accccaccgctcgaccccggcatcgacgagcagttcatgttctatccgacccgcgcgcag
atggattccggctcgatctggctgcggcggctgatgctggagacgggacgggagttggag
aagcggagggccggatag

DBGET integrated database retrieval system