KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2523Help
Entry
bll2523           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bja00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    bll2523
Enzymes [BR:bja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     bll2523
DNA repair and recombination proteins [BR:bja03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     bll2523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-GeneID: 1050286
NCBI-ProteinID: NP_769163
RhizoBase: bll2523
UniProt: Q89S82
Position
complement(2756709..2757524)
Genome map
AA seq 271 aa AA seqDB search
MIPEPAPTVRELLAFYLEAGVDCALTEEPIDRLAEIAAPPPVPRAAAPVEAPRPVAAPAV
IRGEAAPAPDVAIASAREAARTAPTLEALRELMQGFEGCALKHTATRLVFADGNPQARIM
FVGEAPGRDEDIEGLPFVGRSGKLLDLMIGAIGLNRTTAYIANVIPWRPPGNRTPTPQET
QVCLPFIQRQIELVNPDVLVTLGNPSTQTLLGTREGIMRTRGRWFDYETAGRTIRALPTF
HPAYLLRSPSYKRLAWQDLRAIAKVLGQGTV
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgatccccgaacccgcccccaccgtccgagagcttctcgccttctatctggaggccggt
gtcgactgcgcgcttacggaggagccgatagaccgcctggcggaaatcgccgccccgccg
ccggtcccgcgcgcagcagcgccggtcgaggcgccgcggccggtcgccgcgcctgcggtg
atccgaggcgaggccgcacccgcgcccgacgtcgcgatcgcctcggcacgcgaggctgcg
cgcaccgcgccgacgctcgaggcgctacgcgagctgatgcagggcttcgagggctgcgcg
ctgaagcacaccgcaacaaggctggtgttcgccgacggcaatccgcaggcgcgcatcatg
ttcgtcggcgaggcgccgggccgcgacgaggacatcgagggactgcccttcgtcgggcgc
agcggcaagctgctcgatctgatgataggggccataggcctcaaccgcaccacggcctac
atcgccaacgtgattccgtggcggccgcccggcaaccgcacgccgacgccgcaggaaacg
caagtgtgcctgcccttcatccagcgccagatcgagctggtgaaccccgacgtgctggtg
acgctcggcaatccctcgacgcagacgctgctcggaacgcgcgaaggcatcatgcgcacc
cgcggccgctggttcgactacgagaccgctgggcgcaccatccgcgcgctgccgaccttc
cacccggcctatctgctccgctcgccgtcctacaagcggctggcctggcaggatctgcgg
gcgatcgcgaaggtgctggggcaaggcacggtgtaa

DBGET integrated database retrieval system