KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2527Help
Entry
bll2527           CDS       T00109                                 

Definition
(RefSeq) hydrolase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 PGAP1 Esterase Thioesterase Abhydrolase_2 BAAT_C Lipase_3 LIDHydrolase DUF915 LCAT
Motif
Other DBs
NCBI-GeneID: 1050285
NCBI-ProteinID: NP_769167
RhizoBase: bll2527
UniProt: Q89S78
Position
complement(2762460..2763338)
Genome map
AA seq 292 aa AA seqDB search
MASAPQSRFYESHGLRLHYADWGNEGAPPLILVHGGRDHCRSWDVIARSLQPHFHVLAPD
LRGHGDSDWTKGGSYALTEYVYDLAQLVRGVAAPQVTLVGHSMGGMVSLIFTGSFPEQVA
KLVVLDGVTMLPDAPKPPAHERISKWVGQLDKLHDRTPRRYSTLADAAAQMVLHNRRLSR
DLALHLATHGARRNEDGTYSWKFDPYQRASAPHRLWPDDHVELWSRIACPTLLLNAGESF
LAGARAAGLERYFPQARVETIAGAGHWLQHDKPQEVLGEIRRFLGLAEDGAG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggctagcgccccgcaaagccgcttctatgaatcgcacggcctgcggctgcattatgcc
gattggggcaacgagggcgcgccgccgctcatcctggtccacggcggccgcgatcattgc
cgcagctgggacgtcatcgccagatcgctgcaaccgcattttcacgtgctggcgcccgac
ctgcgcggccacggcgattccgactggaccaagggcggcagctacgcgctgacggaatat
gtgtacgatctcgcccagctcgtccgcggcgtcgcagcgcctcaagtgactctcgtcggc
cattcgatgggcggcatggtgagcctgatctttacaggatcgttccccgagcaggtcgcg
aagctggtcgtgctcgacggcgtgaccatgttgccggacgcgccgaagccgccggcgcac
gagcgcatcagcaaatgggtcggccagctcgacaagctgcacgaccgcacgccgcgccgc
tattccaccctcgcggatgccgcagcgcagatggtgcttcacaacaggcggctctcccgc
gacctcgcgctgcatcttgcaacgcacggcgcgcgacggaacgaggacggcacctatagc
tggaagttcgatccctaccagcgcgcctctgcgccgcaccggctctggccggacgatcac
gtcgaactctggtcgcgcatcgcctgcccgacgctgttgctgaatgccggcgaaagcttt
ctggcgggtgccagggccgcaggcctggagcgctatttcccgcaggcgcgtgtcgagacc
atcgccggcgcggggcactggctgcagcatgacaagccgcaggaggtgttgggtgagatc
cggcggtttctcgggctggccgaggacggcgcgggttag

DBGET integrated database retrieval system