KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2551Help
Entry
bll2551           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTPlike_phytase DSPc Y_phosphatase Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 1050243
NCBI-ProteinID: NP_769191
RhizoBase: bll2551
UniProt: Q89S54
Position
complement(2796582..2797088)
Genome map
AA seq 168 aa AA seqDB search
MIHVCSLAALPETVRLTGASHVLTVMANVEQVARPVSVLPANHLKVSMDDITEEMDGFVA
PSEAHIDQVLNFVRRWERSAPLVVHCYAGISRSTASAFAAACALNPHRDEIEIAKKIRAA
SPIASPNRRIVGLADRALGREGRMLRALDEMGPGAMMVEGRPFVIELE
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgtctgttccctcgccgcgcttcccgaaaccgtccgcctcaccggggccagc
cacgtgctgaccgtgatggccaatgtcgagcaggtggcgcggccggtgtcggtgctgccg
gccaaccatctcaaggtgtcgatggacgacatcaccgaggagatggacggctttgtcgcg
ccgtcggaggcccatatcgaccaggtgctgaacttcgtgcgccgctgggaacgcagcgcg
ccgctggtggtgcattgctacgccggcatcagccgctccaccgcgagcgccttcgccgcg
gcctgcgccctcaatccgcatcgcgacgagatcgagatcgcgaagaagatccgcgcggcc
tcgccgatcgcatcgccgaaccggcgcatcgtcggcctcgccgaccgcgcgctgggacgc
gagggccgcatgctgcgcgcgctcgacgagatgggcccgggcgcgatgatggtcgagggt
cgccccttcgtgatcgagctcgaatga

DBGET integrated database retrieval system