KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2563Help
Entry
bll2563           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 1050194
NCBI-ProteinID: NP_769203
RhizoBase: bll2563
UniProt: Q89S42
Position
complement(2805241..2805741)
Genome map
AA seq 166 aa AA seqDB search
MSSMASQPARTHVQTGPEAAAWAERLRVANINPRTGLATDYLNHFNEAVMLLEMVPDMPE
CAEDFLTWSPLSYAEHFTASNFKARDLAIEAYEKADPNVRAQFDHLTDTMTSILTAVGSA
MREVEKDTTRVRLAEQATLWVKPLIAACGGIINGGAEADVDTIMAN
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaatggcctcccaacccgcgcggacgcatgtacagacgggccccgaggcagcg
gcctgggccgaacggctgcgcgtggccaacatcaacccgcggaccgggcttgccaccgac
tatctcaaccatttcaatgaagcggtgatgctgctcgaaatggtcccggacatgccggaa
tgcgccgaagactttctgacctggtcgccgctgtcctatgccgagcatttcacggcgtcg
aacttcaaggcacgcgacctcgccatcgaagcctatgagaaggccgatcccaacgtgcgc
gcccagttcgaccacctcaccgacacgatgacctcgattctgaccgcggtcggctcggcc
atgcgcgaggtcgagaaggacaccacccgcgtccgcctggccgagcaggccaccctctgg
gtcaagccgctgatcgctgcctgcggcggcatcatcaatggcggggcggaagccgacgtc
gacaccatcatggcaaactga

DBGET integrated database retrieval system