KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2567Help
Entry
bll2567           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-GeneID: 1050201
NCBI-ProteinID: NP_769207
RhizoBase: bll2567
UniProt: Q89S38
Position
complement(2809107..2809688)
Genome map
AA seq 193 aa AA seqDB search
MTISDRVRIKDVRVLSDNWTPLKSTTFEYRRANGEWQTQHRETYERDNAAAVLPYNRARR
TVILVRQFRLPVFIRGYDDLLIEAAAGVLDDASPEVRIRAEAEEETGYRLHHVHKVFEAF
MSPGAVTEKLHFFVAEYEPEMRVSDGGGLEHEGEDIEVLELGIDEALAMIADGRIIDAKA
IMLLQYTALHLFR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttccgaccgcgtccgcatcaaggacgttcgcgtgctctcggataactggact
cccctgaagagcacgacgttcgagtaccggcgcgccaacggcgagtggcagacgcagcac
cgggaaacctatgagcgcgacaacgccgccgccgtgctgccctacaatcgcgcgcggcgc
accgtgatcctggtgcgccagttccgcctgccggtgttcatccgcggctacgacgatctc
ctgatcgaggccgcggccggcgtactggacgatgcctctcccgaggtgcgcatccgcgcc
gaggccgaggaggaaaccggctatcgcctgcaccacgtccacaaggtgttcgaggctttc
atgagcccgggcgcggtgaccgagaagctgcacttcttcgtcgccgaatacgaaccggag
atgcgcgtcagcgacggcgggggcctcgagcacgagggcgaggacatcgaggtgctggag
cttggcatcgacgaagcgctggcgatgatcgccgacggacggatcatcgacgccaaggcg
atcatgctgctgcaatatacggcgctgcatctgttcaggtag

DBGET integrated database retrieval system