KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2569Help
Entry
bll2569           CDS       T00109                                 

Definition
(RefSeq) FAD dependent oxidoreductase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD-oxidase_C FAD_binding_4
Motif
Other DBs
NCBI-GeneID: 1050165
NCBI-ProteinID: NP_769209
RhizoBase: bll2569
UniProt: Q89S36
Position
complement(2810142..2811569)
Genome map
AA seq 475 aa AA seqDB search
MNINKPATPPLAPELIEQFRKIVGERHAITDAADIEAYVTEERNLFHGRSPLVLRPGSTA
EVSEICKLASAHRIALVPQGGNTGLVGGQTPHNGEVVVSLRRLDKIREVDTASNTMTCEA
GVVLQIAQQKASDVDRLFPLSLGAEGSCTIGGNLSTNAGGTAALAYGVAREMALGLEVVL
ADGRVLNVLSKLKKDNTGYNLHNLFIGAEGTLGIITAATLKLFPKPRAVETAFVGLKSPA
AALKLLTIAQGEAANALTSFELLSEMAVDFSVRHGIDVRDPLAEKHPWYVLMELSSPGDD
ARTPLETILTRAMEEGIVDDAVIAANLSQRNGFWKLREEMSSAQKPEGGSIKHDISVPVA
AVPAFIDEANAAVVKLIPGARPVPFGHLGDGNLHYNISQPIGADTADYLARWHEMNAVVF
EIVLRMGGSISAEHGIGVLKRDELPEVKDKTAIELMRAIKAMLDPLGIMNPGKVL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaacaagcctgccactcctccgcttgcgcccgagctgatcgagcaattccgc
aagatcgtcggcgagcgccacgcgatcacggatgcggccgacatcgaggcctatgtcacc
gaggagcgcaatctgttccacggccgctcgccgctggtgctgcgtccgggctcgaccgct
gaagtctccgaaatctgcaagctcgcctccgcgcacagaatcgcgctggtgccgcagggc
ggcaacaccgggctcgtcggcggccagaccccgcacaatggcgaggtcgtggtgtcgctg
cgtcggctggacaagatccgcgaggtcgataccgcctccaacaccatgacttgcgaggcc
ggcgtggtgctgcagatcgcgcagcagaaggcatccgacgtggaccgactgtttccgctc
tcgctcggcgcggaaggaagctgcaccatcggcggcaatctctcgaccaatgccggcggg
accgccgcgctcgcctatggcgtcgcgcgcgagatggcgctggggctggaggtcgtgctc
gcggacgggcgcgtgctcaacgtgctgtcgaagctgaagaaggacaacaccggctacaat
ctgcacaacctcttcatcggtgcggaaggcacgctcggcatcatcacggcggcgacgctg
aagctgtttccgaagccgcgggcggtcgagaccgccttcgtcgggctgaagtcgccggcc
gcggcgctcaagctgctgacgatcgcgcagggcgaagccgccaatgcgctgacgagcttc
gagctgctgtcggagatggcggtcgacttctcggtccgccacggcatcgacgtgcgcgat
ccgcttgcagagaagcatccctggtacgtgctgatggaattgtcttcgccgggcgacgat
gcccgcacgccgctggaaacgatcctgacccgcgcgatggaggaggggatcgtcgacgac
gccgtgatcgcggccaacctcagccagcgcaacggcttctggaagctgcgggaggagatg
tcgtcggcgcagaagccggagggcggctcgatcaagcacgacatctcggtgcccgtcgcc
gccgtgcccgccttcatcgacgaagccaatgccgccgtggtgaagctgatccccggcgcg
cggccggtgccgttcggccatctcggcgacggcaacctgcactacaatatcagccagccg
atcggcgccgacaccgcggactacctggcgcgctggcacgagatgaacgcggtggtgttc
gagatcgtgctgcgcatgggcggctcgatctcggccgagcacggcatcggcgtgctcaag
cgcgacgagctgcccgaggtgaaggacaagaccgcgatcgagctgatgcgcgccatcaag
gcaatgctcgacccgctcggcatcatgaatccggggaaggtgctgtga

DBGET integrated database retrieval system