KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2624Help
Entry
bll2624           CDS       T00109                                 

Gene name
pdxH
Definition
(RefSeq) pyridoxamine 5'-phosphate oxidase
  KO
K00275  pyridoxamine 5'-phosphate oxidase [EC:1.4.3.5]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00750  Vitamin B6 metabolism
bja01100  Metabolic pathways
bja01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    bll2624 (pdxH)
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.5  pyridoxal 5'-phosphate synthase
     bll2624 (pdxH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Putative_PNPOx PNP_phzG_C Pyridox_oxase_2 Pyrid_ox_like
Motif
Other DBs
NCBI-GeneID: 1051429
NCBI-ProteinID: NP_769264
RhizoBase: bll2624
UniProt: Q89RY8
Position
complement(2873470..2874111)
Genome map
AA seq 213 aa AA seqDB search
MTDTTSMKHQTPLTSGDFTAADEPFALFETWLNEAIKSEPNDPNAMALATVDPDGLPDVR
MVLMKGFDTEGFVFYSHIASQKGRELAANPKAALLFHWKSLRRQVRIRGNVTPVTDAEAD
AYFATRPKQAQIGAWASKQSEALESRFAFEQAIAKVAAKYIIGEVPRPPGWSGWRITPVR
IEFWHDRPFRLHDRIEFRRDAAGQKWSKTRMYP
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacgacctcgatgaaacaccagacacccttaacatccggtgatttcaccgcc
gctgacgagccttttgcgctgttcgagacctggctgaacgaggcgatcaagagcgagccg
aacgatccgaatgccatggcgctcgcaaccgtcgacccggacggcttgcctgacgtgcgc
atggtgctgatgaagggcttcgataccgagggttttgtcttctacagccacatcgcgagc
cagaagggccgtgaactcgccgcaaatcctaaggcagcgttactttttcactggaagtcg
ctgcgccgtcaggtccgcatccgcggcaacgtgacgccggtgactgacgccgaggccgac
gcctatttcgccacccgccccaagcaggcgcagatcggcgcctgggcgagcaagcagtcc
gaggcgctggagagccgcttcgccttcgaacaggcaatcgcaaaagtcgcggccaaatac
atcatcggcgaggtgccacggccgccgggctggagcggctggcgcatcacaccggtccgc
atcgagttctggcacgatcgcccattccgtctgcacgaccgcatcgaatttcgtcgtgac
gccgccggccagaagtggtccaagacgcggatgtacccttag

DBGET integrated database retrieval system