KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2627Help
Entry
bll2627           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-HC2 DUF4880 DUF4245
Motif
Other DBs
NCBI-GeneID: 1049437
NCBI-ProteinID: NP_769267
RhizoBase: bll2627
UniProt: Q89RY5
Position
complement(2876032..2876802)
Genome map
AA seq 256 aa AA seqDB search
MNDRNIPITEDELHAYVDGELPAERRADVEAWLAAHPDDAERVQSWRDMAEMLHARYDSV
AQEPVPVRLELERLERRPRQWLYGAAAAVLVAFVAGGTAGWIAHGAANSPSTFQSFTADA
LDAHRLYVVEVRHPVEVGGNERDHLQAWLTRRCGWTVFAPNLEASGLKLVGGRLLPGPNG
PASFLMYEGASGERYTIYTAKTENGATQMRYAKTDKDGALFWAERGVGYVVSGGGDRDRL
TKVAQAVYDQAEKNGT
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccgcaatattccgatcaccgaagacgagttgcacgcctatgtcgatggcgag
ctgccggccgagcgccgcgccgacgtcgaggcctggcttgccgcccatcctgacgatgcc
gagcgggtgcagtcctggcgcgacatggccgagatgctgcacgcccgctacgattccgtc
gcccaggagccggtgccggtacggctggagctcgaacggctggagcgccgcccccggcaa
tggctctatggcgccgccgcggctgtgctggttgccttcgtcgccggcggcaccgccggc
tggatcgcgcatggcgccgccaactccccctcgaccttccagagttttacggccgacgca
ctcgacgcccaccgcctctatgtcgtcgaggtccgccaccccgtcgaggtcggcggcaac
gagcgtgaccatctccaggcctggctgacccggcgctgcggctggaccgtgttcgcgccg
aacctggaggcgagcgggttgaagctggtcggcggccggctcctgccagggccgaacggt
ccggcgtcgttcctgatgtatgagggcgcctcgggcgagcggtacacgatctacaccgcc
aagaccgagaatggtgcaacgcagatgcggtacgccaagacggacaaggacggcgcgctg
ttctgggcggagcgcggggtcggctacgtcgtcagcggcggtggcgatcgcgaccggctg
accaaggtggcgcaggccgtgtacgaccaggcagagaaaaacggcacctag

DBGET integrated database retrieval system