KEGG   Bradyrhizobium diazoefficiens USDA 110: bll3593Help
Entry
bll3593           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
KEGG Orthology (KO) [BR:bja00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bja02044]
    bll3593
Secretion system [BR:bja02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bll3593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB BMFP HrcA Takusan DUF4745 Phasin
Motif
Other DBs
NCBI-GeneID: 1051042
NCBI-ProteinID: NP_770233
RhizoBase: bll3593
UniProt: Q89P90
Position
complement(3969180..3970691)
Genome map
AA seq 503 aa AA seqDB search
MGTMAKEAVHKESTTQVKTVEADEFATLLKQSFKPRTERAATEVENAVSTLVQEALKDTS
VIKSDVLDTIEEMIARIDQKLTAQMNEILHTPEFQSIESAWRGLHYLVFNSETDANLKIR
VMNVSKNELYRNLRLYPDARWDQSPLFKQIYEYEFGQLGGEPFGCLIGDYYFSHLPTDVQ
LLRDLSKIAGAAHAPFFSGAEPTLMGMDSWTELSNPRDIGKVFDTPEYAAWKGLRDQDDS
RYLGLCMPRALGRLPYGAKSEPVEEFAFEEETDGHTGDKYGWINAAYAMAVNINRAFKEF
GWCTRIRGVQSGGEVINLPTHTFPTDDGGVDLKCPTEIAISDRREHELAKAGLIPLIHRK
NTDKAAFIGAQSLYKPKKYFGEKGVDATASDNLSSRLPYMFAVSRFAHYLKCMVRDKIGS
MKEKDELTIWLQTWINEYVDANPALSSEAQKARKPLAAAKVEVIANEENPGYYNARFFLR
PHFQLEAMDVGLSLVSRLPGPAS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggggaccatggcaaaagaagctgttcacaaagagagcaccacccaggtcaagaccgtc
gaagctgacgagtttgccactctgttgaagcaaagcttcaaaccccgcacagaacgcgca
gcgaccgaagtcgaaaacgcggtatccacgctcgttcaagaggcgttgaaggacacgagc
gtcatcaagtcggacgtcctcgacaccatcgaggagatgatcgcgcggatcgaccagaag
ctgaccgcgcaaatgaacgaaattcttcacacacctgagttccagtcaatcgaaagtgct
tggcgcggcctccactacctcgtcttcaattccgagaccgacgccaacctcaagatccgg
gtgatgaacgtctccaagaacgagttgtatcggaatctgcggctttaccccgatgcgcgc
tgggaccagagtcccctgttcaagcagatctacgagtatgaattcggccagctgggcggc
gaaccgtttggctgcctgatcggcgactactatttcagccacctcccaaccgacgtacag
ttgctccgcgatctcagcaagatcgccggcgccgcgcacgctcccttcttcagcggcgcc
gagccgacgctgatgggaatggactcttggaccgagctgtccaaccctcgcgacatcggt
aaggtgttcgacacgccggagtatgccgcatggaaggggctgcgcgatcaggacgactcg
cgctatctcggcctgtgcatgccccgcgcgctcggccgcctcccctacggcgcgaaatcg
gagcccgtggaagagttcgccttcgaagaggagacggacggacacaccggcgataaatac
ggctggatcaacgccgcctacgcaatggcggtcaacatcaaccgcgccttcaaggaattt
ggctggtgcacgcggatccgcggcgtgcagtccggtggcgaagtcatcaacctgccgacg
cacacattcccgaccgatgacggcggcgtcgacctgaaatgcccgaccgagatcgccatc
agtgatcgccgcgagcacgaacttgcaaaggcgggcctcatcccgctgatccatcgcaag
aacaccgacaaggccgccttcatcggcgcccagtcactctacaagccgaagaagtacttc
ggcgaaaagggcgtggatgccaccgcgtccgacaacttgtcgtcacgactaccttacatg
ttcgcagtgtcccgctttgcccactatctgaagtgcatggttcgcgacaagatcggatcc
atgaaggagaaggatgagctgacgatctggctgcaaacctggatcaacgaatacgttgat
gccaacccagccctctcgtcagaagctcagaaagcgcgcaagccactggccgctgcgaag
gttgaagtcatcgcaaacgaggagaatccgggatattacaacgcgcgcttctttcttcgt
ccacactttcagttggaggcgatggacgtcggcctcagcctggtttcacgcctacccggc
cccgcttcctga

DBGET integrated database retrieval system