KEGG   Bradyrhizobium diazoefficiens USDA 110: bll3595
Entry
bll3595           CDS       T00109                                 

Gene name
bll3595
Definition
(GenBank) ORF_ID:bll3595; unknown protein
  KO
K11902  type VI secretion system protein ImpA
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
KEGG Orthology (KO) [BR:bja00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bja02044]
    bll3595 (bll3595)
Secretion system [BR:bja02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bll3595 (bll3595)
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: BAC48860
UniProt: Q89P88
Position
complement(3971366..3972706)
AA seq 446 aa
MTEQMDDRCMLDVASLTHPVAADDPCGPDLDAIGDIQYLNFFAGAESLLPMSFFEVVNAN
GERGRFDPKAVDFAGQFAAAQPLLERTRDLRLNLLLAKFSILNRDLDGFLCCLKATNFLL
REQWEAVHPKGEDGDYALRAVTVEAIDVFPTVINPLQFLPLIENRRHGNLNYRAYQVAMG
EIPAGDADADGPDLAAIERIVSETDLDTLKATSARCSAVAAEIAGIKQTWHEKLNAGQPI
SLDRLSGLVNGMAAWLAGLVALRDPAAIAATAEDVGPVDTQAPSDTSGVVTSSAQASAAL
AAAADYFARMEPSNPALLLVRQAQEMVGKSFIEVMRMLVPAHVESAAINIGRDKVFDLPI
ERMAELATSLSSTAESSAQDIVFSIENRAQALGLLTKVASFFRTAEPSSPIPFLVDRARD
LAQRDFLSLLNDVLPEGALKTIDRSH
NT seq 1341 nt   +upstreamnt  +downstreamnt
gtgaccgagcagatggacgatcgttgtatgcttgatgtcgcctccctgacgcaccccgtt
gccgctgacgatccctgcgggccggatctcgacgccatcggagacatccagtatctgaac
ttcttcgcaggtgcggaatcgctgctgccgatgtcgttcttcgaggtcgtcaatgccaac
ggagagcgtggacgcttcgatccaaaggcagtcgattttgccggccaattcgccgccgcg
cagcccctcctggagcgtacccgcgatctgcgcctaaacctgctgctggccaagttttca
atcctcaaccgcgatctcgacggctttctctgctgcctgaaggcgaccaacttcctgctg
cgcgagcagtgggaagcggtgcatccgaagggcgaggacggcgactacgcccttcgcgcc
gtcacggtcgaggcaatcgacgtgttcccgaccgtgatcaacccgctccagttccttccc
ctgatcgagaaccgcagacacggcaacctcaactaccgtgcttatcaggtcgccatgggc
gaaattcccgccggcgacgccgacgccgacggacctgatctggcggccatcgagcgcatc
gtcagcgagacggatctcgacactctcaaggcaaccagcgcgcggtgctccgcggtcgcg
gctgaaatcgcgggtatcaaacaaacctggcacgagaagttgaacgcggggcaaccgatc
agcctcgacaggctctccggcctggttaacggcatggctgcctggcttgcgggtcttgtc
gcgttgcgcgatccggccgcgatcgctgcaaccgcggaagatgtcggtcctgtcgataca
caggcgccgtcagacacgagcggggtggtgacttcatccgcacaggcatctgcagcgctt
gcagcggcggccgactattttgcccgaatggaaccatccaacccggcactgttgctggtg
cgtcaagcgcaggagatggtgggcaagtcattcattgaagttatgcggatgctggtgcct
gcgcacgtggagagcgctgcgatcaacatcgggcgcgacaaggtcttcgacctgccgatc
gaacggatggcggaactcgctacctcgctctcatcgacggcagagagcagcgctcaagat
attgtattttcaatagaaaacagggcgcaggccttaggcctgctgacgaaggtggcgtcg
tttttccgaaccgcggagccgtccagccccatcccctttttggtcgatcgcgcgcgcgac
ctcgcgcaacgagattttctcagccttttgaatgatgttcttcctgagggagcccttaaa
acaatcgacagatcgcattga

DBGET integrated database retrieval system