KEGG   Bradyrhizobium diazoefficiens USDA 110: bll5044
Entry
bll5044           CDS       T00109                                 

Gene name
mntH
Definition
(RefSeq) manganese transport protein MntH
  KO
K03322  manganese transport protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
KEGG Orthology (KO) [BR:bja00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bja02000]
    bll5044 (mntH)
Transporters [BR:bja02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   bll5044 (mntH)
SSDB
Motif
Pfam: Nramp
Other DBs
NCBI-GeneID: 1051841
NCBI-ProteinID: NP_771684
RhizoBase: bll5044
UniProt: Q89K67
Position
complement(5593664..5595016)
AA seq 450 aa
MDARSPDLTTDAAGWRTDVPTTKSLAEVNASVALPTAGVWWRRLLAFVGPGYLVSVGYMD
PGNWATDLAGGSKFGYTLLSVILLSNLMAILLQSLAARLGIVTDRDLAQACRATYSPAVN
FLLWLACEAAIIACDLAEVIGTAIALKLLFGIPLIGGALIAALDAFLLLLLMNRGFRFLE
AFVIALLAVIAVCFAVQIVAAAPPVAEVLHGFMPKSEIFTNPEMLYIAIGIIGATVMPHN
LYLHSSIVQTRAYERNETGRREAIKWATTDSTIALMLALFINAAILVVAAATFHKSGHSD
VAEIGQAFELLSPLLGLGIASTLFAIALLASGLNSTVTATLAGQIVMEGFLDLRLPSWAR
RLLTRGIAIIPVIIVTAIYGERGTADLLVFSQVVLSMQLPFAVIPLVRFVSDRRKMGKFA
ISPYVAAIAWIVAGVIVVLNLKLLADTLLG
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggatgcccgatcgcccgatttaaccaccgacgccgccggctggcgcaccgacgtgccg
accacaaaaagcctggccgaggtgaatgcctccgtcgccctccccacggcgggggtgtgg
tggcggcggctgctcgccttcgtcggtccgggctatctcgtctcggtcggctacatggat
cccggcaactgggcgaccgacctcgccggcggatcgaagttcggctacacgctgctctcg
gtcatcctgctctccaacctgatggcgatcctgctccagtcgctggcggcgcggctcggc
atcgtcacggaccgcgacctcgcgcaggcctgccgcgcgacctattcgccggcggtgaac
ttcctgctctggctcgcctgcgaggcggcgatcatcgcctgcgatctcgccgaggtcatc
ggcacggcgatcgcgctcaagctcctgttcggcatccccctgatcggcggcgcgctgatc
gccgcgctcgatgccttcctgctgctgctattgatgaaccgcggcttccgtttcctggaa
gccttcgtcatcgcgctgctcgcggtgatcgcggtttgcttcgcggtccagatcgtggcc
gcggcgccgccggtcgcggaggtcctgcatggcttcatgccgaagagcgagatcttcacc
aatccggagatgctctacatcgcgatcggtatcatcggtgccaccgtgatgccgcataat
ctctatctgcactcctcgatcgtgcagacgcgcgcctatgagcgcaacgagacaggccgg
cgcgaggcgatcaaatgggcgacgacggactcgaccatcgccctgatgctggcgctgttc
atcaacgccgcgatcctcgtggtcgccgcggcaaccttccacaagagcggccattccgac
gtcgccgagatcggccaggctttcgagctcttgtcaccgctgctcggcctcggtatcgcc
tcgacgctgtttgccatcgcgctgctggcctcgggcctcaactcgacggtgaccgcgacg
cttgcaggccagatcgtgatggagggttttctcgatctgcgcctgccaagctgggcgcgc
cgcctgctcacgcgcggcatcgcgatcattccggtgatcatcgtcacggcgatctacggc
gagcgcggcacggccgatctcttggtgttcagtcaggtcgtgctgtcgatgcagctgccc
ttcgccgtcatcccgctggtccgcttcgtctccgatcgccgcaagatgggcaagttcgcg
atttccccgtacgtcgctgcgatcgcgtggatcgtcgcgggcgtcatcgtggttttgaat
ctgaagctgctggcggatacgctgttggggtga

DBGET integrated database retrieval system