KEGG   Bradyrhizobium diazoefficiens USDA 110: bll6732Help
Entry
bll6732           CDS       T00109                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00480  Glutathione metabolism
bja00590  Arachidonic acid metabolism
bja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    bll6732
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    bll6732
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     bll6732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 1050023
NCBI-ProteinID: NP_773372
RhizoBase: bll6732
UniProt: Q89FG8
Position
complement(7417116..7417592)
Genome map
AA seq 158 aa AA seqDB search
MSAIYDFKANSLLGEEVPMRRFEGQVLLIVNTASKCGFTPQYRGLEDLYRDLSPRGFAVL
GFPCNQFGAQEPGQASEIQEFCSTNYDVTFPLFEKIDVNGANAHPLYEYLKRQQSGLLGA
SIKWNFTKFLVDRAGRVIARYAPTARPEGLRQQIETLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgatttacgacttcaaggccaactcgctgctcggcgaggaagtgcccatgcgc
cggttcgaagggcaggtgctcctgatcgtcaacaccgcgagcaaatgcggcttcacgccg
caatatcgcggccttgaggatctctaccgcgatctctcgccgcgcggcttcgcggtgctc
ggctttccctgcaaccagttcggcgcgcaggagccggggcaggcgagcgagatccaggaa
ttctgctcgaccaattacgacgtcacctttcccctgttcgagaagatcgacgtcaacggc
gccaacgcgcatcccttgtatgagtatctgaaacgccagcaatccgggctcctcggcgcc
tccatcaaatggaatttcaccaaattcctggtggaccgtgccggccgggtgatcgcgcgc
tacgcgccgaccgcgcggcccgaaggattgcggcagcaaatcgagaccctgttatga

DBGET integrated database retrieval system