KEGG   Bradyrhizobium diazoefficiens USDA 110: bll7981Help
Entry
bll7981           CDS       T00109                                 

Definition
(RefSeq) dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00010  Glycolysis / Gluconeogenesis
bja00071  Fatty acid degradation
bja00350  Tyrosine metabolism
bja00625  Chloroalkane and chloroalkene degradation
bja00626  Naphthalene degradation
bja00680  Methane metabolism
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01120  Microbial metabolism in diverse environments
bja01130  Biosynthesis of antibiotics
bja01200  Carbon metabolism
bja01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bll7981
  09102 Energy metabolism
   00680 Methane metabolism
    bll7981
  09103 Lipid metabolism
   00071 Fatty acid degradation
    bll7981
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    bll7981
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    bll7981
   00626 Naphthalene degradation
    bll7981
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     bll7981
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     bll7981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 1049972
NCBI-ProteinID: NP_774621
RhizoBase: bll7981
UniProt: Q89C17
Position
complement(8762725..8763768)
Genome map
AA seq 347 aa AA seqDB search
MDIKTAKAAILVESGKPLIVDEFTLPDTLEHGQVLAHVHTSSICGAQINEIDAVKGADKF
LPHLLGHEALATIVETGPGVVSCKQGDTVVMHWRPGKGIQSNTPVYSWHGKRLNAGWVTT
FNEYAVVSENRVTPVPPSIDRSSAPLLGCAVTTALGVVNNDAQVAIGEAVLVFGVGGVGL
NIVQFAAMVGAHPVVAIDRLDNKLEMARQFGATHTINSDAVKDLAAEVRSITGPDGPDKV
VETTGVSRLIELAYEVTAKKGRCILVGVPRDKVEIYTLPLHFEKVLKGSEGGQCQPARDI
PRLVRLDEAGKVSYRGIVTHEFALDDINDALDLMRSGTSGRILLNIS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggatatcaagaccgcgaaggctgcgattctcgtcgagtcgggcaagccgctgatcgtc
gacgagttcaccttgccggatacgctcgaacacggccaggtgctcgcgcacgtgcacacg
tcgagcatctgcggcgcacagatcaacgagatcgacgccgtcaagggcgccgacaagttc
ctgccgcacctcttggggcacgaagcgctggcgaccatcgtcgaaaccgggcccggcgtc
gtctcgtgcaagcagggcgacaccgtcgtcatgcattggcggccgggcaagggcatccag
tccaatacgccggtctattcctggcacggcaagcgactcaacgcgggctgggtcaccacc
ttcaacgaatatgccgtggtgtcggaaaatcgcgtcacgcccgttcccccctcgatcgat
cgcagcagcgcgccgctgctcggctgcgcggtgacgaccgccctcggcgtcgtcaacaac
gacgcgcaggtcgcgatcggcgaggccgtcctcgtgttcggcgtcggcggcgtcgggctg
aacatcgtgcaatttgccgcgatggtcggcgcccatccggtcgttgcgatcgaccgcctc
gacaacaagttggagatggcgaggcagttcggcgccacccacaccatcaactccgacgcg
gtaaaggatctggccgccgaggttcggtccatcacggggcctgacgggcccgacaaggtc
gtcgagaccaccggcgtcagccgtttgatcgagctcgcctacgaggtcaccgcgaagaag
ggccgctgtatccttgtcggtgttccccgcgacaaggtcgagatctacacgctgccgctg
cacttcgagaaggtgctgaagggttcggaaggcgggcagtgccagccggcgcgcgacatc
ccgcgtctcgtccggctcgacgaagccggcaaggtcagttaccgcgggatcgtgacccac
gagttcgcgctcgatgacatcaacgacgcgctggatttgatgcgcagcggcacgtcaggg
cggatcttgctaaacatcagctga

DBGET integrated database retrieval system