KEGG   Bradyrhizobium diazoefficiens USDA 110: bll8127Help
Entry
bll8127           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
  KO
K06985  aspartyl protease family protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: gag-asp_proteas Asp_protease_2 RVP
Motif
Other DBs
NCBI-GeneID: 1049009
NCBI-ProteinID: NP_774767
RhizoBase: bll8127
UniProt: Q89BM1
Position
complement(8918669..8919184)
Genome map
AA seq 171 aa AA seqDB search
MMRNIMILAAIMIGLGTFMAQMADRMSSASATSAPRTTVAVATTAPAGGRSLAIGRDGRG
HFQTEGRIEGQRIGFMVDTGASVVALNETSAARFGLRPSRGEYNATVSTANGTIKAARTR
IAMLEVGGLVVRDVDAMVLPDEALSENLLGLSFLSRLKRFEYANGQMVLEQ
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgtaacataatgatcctcgcggccatcatgatcggcctcggcaccttcatggcg
cagatggcggacaggatgagctccgcttccgccacgtcagcgccgcgcacgacggtcgcg
gtcgcaaccacggcgccggccggtggccgcagcctcgccattggccgcgacggccgtggc
catttccagaccgagggccggatcgagggccagcgcatcggcttcatggtcgacaccggc
gcctccgtcgttgcgctgaacgagacctcggccgcccgcttcggcctgcgtccctcgcgc
ggcgagtacaacgccaccgtctccaccgccaacggcaccatcaaggccgcgcgcacccgc
atcgccatgctggaggtcggcggcctcgtcgtgcgcgacgtcgacgccatggtgttgccg
gacgaggcgctgtcggaaaacctgctcggcctctccttcctgtcccgcctgaagcgtttc
gagtacgccaacgggcagatggtgctggagcagtag

DBGET integrated database retrieval system