KEGG   Bradyrhizobium diazoefficiens USDA 110: bll8128Help
Entry
bll8128           CDS       T00109                                 

Definition
(RefSeq) helicase
  KO
K03579  ATP-dependent helicase HrpB [EC:3.6.4.13]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
KEGG Orthology (KO) [BR:bja00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    bll8128
Enzymes [BR:bja01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     bll8128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HrpB_C Helicase_C HA2 DEAD Flavi_DEAD AAA_30
Motif
Other DBs
NCBI-GeneID: 1049011
NCBI-ProteinID: NP_774768
RhizoBase: bll8128
UniProt: Q89BM0
Position
complement(8919311..8921746)
Genome map
AA seq 811 aa AA seqDB search
MLDDLSRTLEAHNAAVLVAPPGAGKTTRVPLALLDAPWAKGKKIIVLEPRRIAARASADR
MAKSLGERAGETVGYRVRFGSKISRATRIEVVTEGIFTRQIMDDPELSGVAAVLFDEFHE
RSLDADMGLALARDAQTGLREDLRILVMSATLDGARVAKLLGEAPVVESEGRAFPVETRY
LGRKADAPIERQMADAIASALRADGGSVLAFLPGAAEIRRTQNFLGERVQDASIEIVPLF
GALDAAAQDRAIAPAPKGTRKVVLATSIAETSLTIEGVRIVVDSGLARVPRYEPDIGLTR
LETVRASRAAVDQRRGRAGRTEPGVCYRLWDEPQTASLAPYTQPEILSADLSSLVLDLAQ
WGVTDPAALSFLDPPPQPAWKEAKSLLSELNALDGDGRITAEGKSLRALALPPRLARMIV
DSHRAGAGGDAAEIAAILTERGLGGDSADLEHRRDQFRRDRSPRASSARDLARRWASQVA
ASEKEGPQEDLSTGLMLAYAFPDRVARNRGNGSFVLANGRGAAVEQTSSLARAPYIAIGE
MTGTAASGRILLAAQITEDDIERHFAEHIETVDEISFDRGAMALRARRKRALHAITLSEA
TLAVSPSEETARIFADGLIAAGLDRLPWSKAAEQWRDRVMFLRKAEGDSWPDLSDDGLIV
RRDDWLVPALYDKIALKDISAGDLSDALMALLPWEMRARLDREAPTHFEAPTGTVLAIDY
EAEQGPTIAVRLQELFGLNTHPSIAAGKVPLVLELLSPAQRPVQVTRDLPGFWRGSYAAV
RSDLRGRYPRHPWPEDPANALPTRRVKPRGT
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgacgatttgtcgcgcacgctcgaggcacacaatgcggccgtgctggtggccccg
cccggcgccggcaagaccacgcgcgtgcctctggcgctgctcgatgcgccctgggccaag
ggcaagaagatcatcgtgctggagccgcggcgcatcgcggcgcgcgccagcgccgatcgc
atggccaaatcgctcggcgagcgggcaggtgagaccgtcggctaccgcgtccgtttcggc
tcgaaaatatcgcgcgcgacgcgcatcgaggtcgtgaccgaaggcatcttcacccgccag
atcatggacgatcccgagctctccggcgttgccgccgtcctgttcgacgaatttcacgag
cgttcgctcgacgccgacatgggccttgcgctggcgcgtgacgcgcaaaccggcctgcgc
gaggatctgcgcattctcgtgatgtcggcaacgctcgacggcgcccgcgtcgcaaagctg
ctcggtgaggcgcccgtcgtcgaaagcgagggccgcgcctttccggtcgagacgcgctat
ctcggccgcaaggcggacgcgccgatcgagcggcagatggcggatgcgatcgcctcggcg
ttgcgcgccgatggcggttcggtgctggcgttcctgcccggcgccgctgaaatccgccgc
acccagaatttcctcggcgagcgcgtccaggacgccagtatcgagatcgtgccgctgttc
ggcgcgctcgatgccgccgcgcaggatcgcgccattgcgcccgcgccgaagggcacgcgc
aaggtggtgctggcgacctcgatcgcggagacctcgctcaccatcgaaggcgtgcgcatt
gtcgtcgattccggtcttgcccgcgtgccgcgctacgagcctgatatcggcctgacccgg
ctcgagaccgtgcgcgcctcgcgcgcggcggtggatcagcgccgcggccgcgccggccgc
accgagccgggcgtctgctaccggctctgggacgagccgcagacggcgtcgctcgcgccc
tacacccagccggaaatcctcagcgccgatctgtcctcgctcgtgctcgatctggcgcaa
tggggcgtcactgaccccgccgcgctgtcgttcctcgacccgccgccgcagccggcctgg
aaggaagccaagagccttctcagcgagctcaatgcgctggatggcgacggccgcatcacc
gccgagggcaagagcctgcgcgcgctggcattgccgccgcggctggcgcgcatgatcgtg
gattcgcatcgcgccggcgcgggcggagacgccgccgagatcgcggcgatcctcaccgag
cgcgggctcggcggcgacagcgccgatctcgagcaccggcgcgaccagttccgccgcgac
cgctcaccgcgcgcatcgagtgcgcgcgaccttgcccggcgctgggcctcgcaggtcgcg
gcgtcagagaaggaggggccgcaggaagatctctcgaccggcctgatgctcgcctatgcc
ttcccggaccgcgtcgcgcgcaatcgcggcaacggcagtttcgtgctcgccaacggtcgc
ggcgccgccgtcgagcagacctcgtcgctcgcccgcgcgccctatatcgcgatcggcgaa
atgacgggcacggcggcgagcggccgcatcctgctcgccgcgcaaatcaccgaggacgac
atcgagcggcatttcgccgagcatatcgagaccgttgacgagatctcgttcgatcgcggc
gcgatggcgctgcgtgcacggcgcaagcgcgcgctgcatgcgatcacgctctctgaagct
acgctggctgtgtcgccgtcggaggagaccgcgcgcatcttcgcggatggtctgatcgcc
gcgggcctcgaccggttgccctggtcgaaggcggccgagcaatggcgcgaccgcgtgatg
ttcctgcgcaaggccgaaggcgacagctggcctgacctgtccgacgacgggctgatcgtg
cggcgcgacgactggctggtgcccgcgctctacgacaagatagcgctcaaggatatctcc
gccggcgatctctccgatgcgctgatggcgctgttgccgtgggagatgcgcgcacggctc
gaccgcgaggcgccgacgcatttcgaggcgccgaccgggaccgtgctcgcgatcgactac
gaggccgagcaggggccgaccatcgcagtgcggctccaggagttgtttggcctcaacacc
catccgtcgatcgcggccggcaaggtgccgctggtgctggaattgctgtcgccggcgcag
cgcccggtgcaggtgacgcgcgatctccccggtttctggcgcggcagctacgccgcggta
cgctccgacctgcgcggccgctacccgcgccatccctggccggaagatccggcgaatgca
ttgccgacccggcgggtcaaaccgcgcggcacctga

DBGET integrated database retrieval system