KEGG   Bradyrhizobium diazoefficiens USDA 110: bll8157Help
Entry
bll8157           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YkuD
Motif
Other DBs
NCBI-GeneID: 1048647
NCBI-ProteinID: NP_774797
RhizoBase: bll8157
UniProt: Q89BJ1
Position
complement(8959502..8959945)
Genome map
AA seq 147 aa AA seqDB search
MNGQCARLAMRVVTAAFVLAGYCVTPARADLRVDIDKSSQRMSVRVDGAPRYSWPVSTGC
SGYGTPSDTFHPQAMMRRYFSRRYYNSPMPHAIFFHYGFAIHGTTDIYRLGGPASHGCVR
LHPAHAAALFALVQREGARNTTIRISN
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggcaatgtgcacggctcgcgatgcgggtcgtgactgcggcgtttgtgctggcg
ggatattgcgtgacgccggcgcgggccgacctcagggtggatatcgacaaatcgtcacag
cgcatgtcggtgcgtgtcgacggcgcgccgcgctacagctggccggtgtcgaccggctgc
agcggctacggcacgccgagcgacaccttccatccgcaggcgatgatgcggcgctacttc
tcgcgcaggtactacaattcgccgatgccgcacgcgatcttcttccattacggcttcgcc
attcacggcacgaccgacatttaccgcctgggcgggccggcctcgcatggctgtgtccgc
ctgcatcccgcgcatgcggccgccctgttcgcgctggtccagcgcgagggtgcgcgcaac
accacgatccgtatttccaattag

DBGET integrated database retrieval system