KEGG   Bradyrhizobium diazoefficiens USDA 110: bll8163Help
Entry
bll8163           CDS       T00109                                 

Gene name
gtrA
Definition
(RefSeq) glycosyl transferase family protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_trans_1_4 Glycos_transf_1 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_2
Motif
Other DBs
NCBI-GeneID: 1048621
NCBI-ProteinID: NP_774803
RhizoBase: bll8163
UniProt: H7C6S9
Position
complement(8964264..8965301)
Genome map
AA seq 345 aa AA seqDB search
MRVLVATDAWRPQINGVVRSLEYLASEAPSFGASIGFLTPGDFPTVPLPGYREIRLALAS
VGRIERAIKSMGPDSVHIATEGPIGWITRHVCQTRGYPFTTSYHTRFPEYLAERLPVPLR
WSYAVLRRFHNGGDGIMVGSPTLEQALKAHGFRNLMPWSRGVDAVLFRPRSVQPLAFPAP
VFLYVGRIAIEKNLEAFLALDLPGSKVVVGDGPLRASLQARFPQVHFLGTRTGRALADVY
ASADVFVFPSLTDTFGLVILEALACGLPVAAFPVMGPLDVIGESGCGCLDADLRRAALAA
LQVPREKCRAYALTFTWQESVRQFLDNVKRAHGMLTDAARPLFAG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctggtggcaaccgacgcctggcgcccacagatcaacggcgtggtgcgctcg
ctcgaatatctcgccagcgaagcgccttcgttcggcgccagtatcggcttcctcacgccg
ggcgatttccccaccgtgccgctgcccggctaccgggagatccgcctcgcgctggcctcg
gtggggcgaatcgagcgcgcgatcaaaagcatgggtccggattccgtgcacatcgcgacc
gaggggccgatcgggtggatcactcgccatgtctgccagacccgcggctatccgttcacg
acgagctatcacacccgctttcctgaatatctggcggagcggctgccggtgccgctgagg
tggagctatgcggtactgcgccgtttccacaacggcggcgacggcatcatggtcggctcg
ccgacgctggagcaggccctgaaggcgcatggcttccgcaacctgatgccttggtcgcgc
ggcgtcgatgccgtgctgtttcgtccgcgcagcgtgcagccgctcgcctttccggcgccg
gtgtttctgtatgtcggccgcatcgcgatcgagaagaacctcgaggctttccttgccttg
gacctgccgggctcgaaggtcgtggtcggcgacgggccgttgcgtgcgagcctgcaggcg
cggtttccgcaggtccattttctcggcacgcgaaccgggcgagcactcgccgatgtctac
gcgtcagccgatgtcttcgtctttccgagcctgaccgatacgttcgggttggtgatcctc
gaagcgttggcgtgcggcctgccggttgcggccttcccggtgatggggccgctcgatgtg
atcggagagtccggatgcggctgtctcgatgccgacctgcgccgcgcggcgctcgccgcc
ctgcaggtgccgcgcgaaaaatgccgggcctatgccctgactttcacttggcaggaaagc
gtgcggcagtttctcgacaacgtcaagcgggcgcatggcatgctgaccgacgccgcgcgg
ccgctgttcgcgggctga

DBGET integrated database retrieval system