KEGG   Bradyrhizobium diazoefficiens USDA 110: bll8199Help
Entry
bll8199           CDS       T00109                                 

Definition
(RefSeq) transposase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IstB_IS21 Bac_DnaA ResIII AAA PhoH AAA_16 AAA_25 Sigma54_activat AAA_19 TIP49 T2SSE NACHT ATPase AAA_30 6PF2K DEAD AAA_5 TsaE Torsin AAA_28
Motif
Other DBs
NCBI-GeneID: 1048412
NCBI-ProteinID: NP_774839
RhizoBase: bll8199
UniProt: Q89BF5
Position
complement(9001685..9002548)
Genome map
AA seq 287 aa AA seqDB search
MERTQIFDLMGELKLYGMKAAFDEIMATAVKRQHEPQRIVGDLLSAEINEKQARSIKYQL
TIAKLPLAKDIADFQFDGTPINQTLVNDLAGGGFVAQQRNVVLVGGTGTGKTHLAIAIAR
SCIRSGARGRFFNVVDLVNRLETETRNGRQGRLAEHLTRMDFIVLDELGYLPFAQSGGQL
LFHLVSRLYERASVIVTTNLAFGEWPSVFGDAKMTTALLDRLTHHCDIVETGNDSWRFKS
RDDDHATRARLASAIPASSDETSATSKPRRGKGSKLDADEGSNLQAD
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaactcaaatcttcgacctcatgggcgagctcaagctctatggcatgaaggct
gccttcgacgagatcatggcaactgccgtcaaacgtcagcatgaaccccagcgcatcgtt
ggcgatctactctccgccgagatcaacgagaagcaagccagatctatcaaataccagctc
accattgccaagctgccgcttgccaaggacattgccgacttccagttcgacggcacgccg
atcaatcagacgctcgtcaatgatcttgctggcggcggcttcgtcgcccaacagcgcaac
gtcgtgctggtcggcggcaccggcacaggcaaaacccacctggccattgccatcgcaaga
agctgcatccgatctggtgcccgcggccgcttcttcaacgtggtcgacctcgtcaaccgc
ctcgagaccgagacccgcaatggacggcagggacggcttgccgagcatctgacccggatg
gacttcatcgtgctggacgaactcggctatttgcccttcgcccagtccggtggccagctt
ctcttccacctcgtcagccggctctatgagcgcgcctccgtcatcgtgaccaccaatctc
gcattcggcgaatggcccagcgtgttcggcgacgccaaaatgaccacagcgttgctcgac
cgattgacccatcactgcgacatcgtcgagaccggcaacgatagctggcggttcaaaagc
cgagacgacgatcacgccacccgcgctcgtctcgcctccgctatcccggccagctccgac
gagacgagcgctaccagcaaaccccgccgcggaaaggggtcaaaattggacgccgatgaa
gggtcaaatttgcaagccgattga

DBGET integrated database retrieval system