KEGG   Bradyrhizobium diazoefficiens USDA 110: bll8205Help
Entry
bll8205           CDS       T00109                                 

Definition
(RefSeq) maturase; reverse transcriptase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RVT_1 Sirohm_synth_C GIIM DUF3110
Motif
Other DBs
NCBI-GeneID: 1048295
NCBI-ProteinID: NP_774845
RhizoBase: bll8205
UniProt: Q89BF0
Position
complement(9007492..9008250)
Genome map
AA seq 252 aa AA seqDB search
MAEGGGVLEDSVVAADDRGTGQGSVISPLLGNIYLHYALDLWAKRRRQREVSGGMIIVRY
ADDVVVGFEREDDARRFLDAMRARLEEFELTLHPAKTRLIEFGRHAAAQRKQRGLGKPET
FAFMGFTFICGKSRQGRFQLQRKTRSDRLRTKLREIKEELRRRMHWPIPAQGKWLRQVLT
GHFAYFAVPTNGRALNAFRFYLTDLWRRTLRRRSQRTCLTWDRITQITDDWLPKARILHP
WPKLRFAVKHPR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaggcgggggtgttctcgaagacagcgtcgtagccgctgatgacaggggaacg
ggtcaaggttcggtgatttcaccgcttctcggcaacatctacctgcactacgctctcgac
ctgtgggccaaacgccggcgacagcgcgaggtctccggcggcatgatcatcgtgcgttac
gcggacgatgtagtagtcggctttgagcgcgaggatgacgcacgtcgtttccttgacgcg
atgcgcgcgagactggaggagttcgagctgacgctccatccggccaagacccgcctgatt
gagtttggtcgccatgcggcggctcaacgcaagcagcgcggactcggaaagccggaaacc
tttgcgttcatggggttcacgtttatctgcggcaaatcacgccaagggcgcttccagctt
caacggaagacccgtagcgaccgcttgcgaaccaaactccgcgaaatcaaggaggagcta
aggcgccgaatgcactggccgatccctgcacaagggaaatggctgaggcaggtcttgacc
ggccactttgcgtactttgctgtcccgacgaatggccgagcgctcaatgcgtttcggttc
tatctgaccgatctctggaggcggacgcttcggcggcgcagtcagcggacctgtctgacc
tgggatcgcataacgcagatcaccgatgactggctccccaaggctcgcatccttcatcca
tggccgaagctgcgcttcgccgtcaaacacccgaggtag

DBGET integrated database retrieval system