KEGG   Bradyrhizobium diazoefficiens USDA 110: bll8212Help
Entry
bll8212           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Pyr_redox_2 Pyr_redox DAO SE Amino_oxidase Pyr_redox_3 Trp_halogenase NAD_binding_8 FAD_binding_2 Lycopene_cycl GIDA FAD_oxidored AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 1048272
NCBI-ProteinID: NP_774852
RhizoBase: bll8212
UniProt: Q89BE3
Position
complement(9010444..9011577)
Genome map
AA seq 377 aa AA seqDB search
MGAVKKVFIVGGGIGGLTVAHALQRIGVSTRVIEMGDKRDRIGTGITLLGNALRALAELG
LVDACLEGGLGWDTVSVRDGAGTILSEQSSPRIWDADRPAALGLMRPRLGQILEDFATKS
GAKIDFNTTITRIDQDDRGVTVQLSNGETDRADLLIAADGVYSKIRQSIFGDEFKPHYAG
QGVWRYTVSRTEAMNGFVLYRLPTGRVVGALPLSKELCYLFFLESTDEKLRIPQDRVCDY
LRNLLAPFTAPELVAAAKVIGEDKHISYRPFDVLMMPAPWHRGRVVLLGDAAHSLMPQMT
SGGGMAIEDALVLAQELNRNDDLETALKTYCRRREERVGRVYDIAYAICREERKPEHGRD
YSMGLLREGYAFLAAPV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggtgaagaaggttttcatcgtaggtggcgggattggcggcttgacggtcgcc
catgcgcttcagcggataggcgtatctaccagagtcattgagatgggagataagcgtgac
cggatcggcaccggtatcacgctgctggggaatgccttgcgggcacttgccgaattggga
ttggtggatgcctgcctcgaaggcggccttggttgggataccgtgtcggtacgcgatggc
gcgggaacgattctgagcgaacagtcctcaccaagaatttgggacgctgatcgtccagcc
gcactgggactcatgcggccacgtctgggacagattctggaagactttgcgacgaagagc
ggcgcgaaaatcgatttcaacacaacgatcacccgtattgatcaggacgatcgaggggtg
acggttcagctatcgaacggcgagacagatcgcgccgatctgctgatcgctgcggatgga
gtctattccaagatccgccagagcatcttcggcgacgagttcaagccgcactacgccggc
caaggggtatggcgttatacggtttctcgcaccgaggcgatgaatggcttcgtcctgtac
cgccttccgacgggccgcgtagttggcgcgctgccgctatcgaaggaattgtgctatcta
ttcttcctggaaagcacggacgaaaagcttcgtattccgcaagatcgggtgtgcgactat
ctccgtaacctgctcgccccctttacggcgcccgaactggtcgcggctgccaaggtgatc
ggcgaagacaagcacataagctaccgcccatttgatgtcttgatgatgccagccccctgg
caccgtggccgtgtcgtgctgctcggcgatgctgcccattcgttgatgccgcaaatgaca
tccggcggcggaatggcgatcgaggatgcgctggttctggcccaggaactgaatcgcaac
gacgatctggagactgcgctcaagacctattgccgacgccgcgaagaaagagtcgggcgc
gtatacgacattgcatacgccatttgccgggaagagcgcaaaccggagcatggccgcgac
tattcgatgggccttcttcgtgaaggctacgcgtttctggctgcgcccgtctga

DBGET integrated database retrieval system