KEGG   Bradyrhizobium diazoefficiens USDA 110: bll8238Help
Entry
bll8238           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
  KO
K07484  transposase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
KEGG Orthology (KO) [BR:bja00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    bll8238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TnpB_IS66
Motif
Other DBs
NCBI-GeneID: 1048218
NCBI-ProteinID: NP_774878
RhizoBase: bll8238
UniProt: Q89BC0
Position
complement(9028763..9029119)
Genome map
AA seq 118 aa AA seqDB search
MIIPAQGLRIVLAVRPVDFRCGHDALAGLVQNTLGLDPHSGLIVVFRSKRADRLKILLWD
GTGLVLVYKRLGRDGRFEWPQISDGVMHLTRVQFEALFEGLNWKRVGERIVATPAAAN
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgatcattccggcgcagggactgcggattgtgcttgctgtgcgtcctgttgacttccgg
tgcgggcacgacgcgctggccggtcttgtgcaaaacacgcttgggctcgatccgcattcg
ggcctgatcgtggtttttcgttcgaagcgcgccgaccggctgaagattttgctatgggac
ggcacgggcctcgttttggtctacaagcgccttggccgcgatggtcgtttcgagtggccg
cagatcagcgacggcgtcatgcatctgacgcgcgtgcagttcgaagcgctgtttgaaggg
ctgaactggaagcgagtgggcgaacggattgtcgcgacgccagctgcggcgaactga

DBGET integrated database retrieval system