KEGG   Bradyrhizobium diazoefficiens USDA 110: blr0315Help
Entry
blr0315           CDS       T00109                                 

Gene name
nosZ
Definition
(RefSeq) nitrous-oxide reductase
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00910  Nitrogen metabolism
bja01120  Microbial metabolism in diverse environments
Module
bja_M00529  Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    blr0315 (nosZ)
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     blr0315 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupredoxin_1 COX2 Cu-oxidase_3 TAT_signal
Motif
Other DBs
NCBI-GeneID: 1052167
NCBI-ProteinID: NP_766955
RhizoBase: blr0315
UniProt: Q89XJ6
Position
326883..328835
Genome map
AA seq 650 aa AA seqDB search
MSDSDNIKGVSRRTLLGTTAAAAGVGLAGGAVVTKDGAGFVSTADAQTKSAAPKAPPARP
AVQKTEVAPGELDEYYVFFSSGQSGEMRIIGLPSMRELMRVPVFNRCSATGWGQTNESLK
VLTEGMQPATREFLKNRGGTFMNGDLHHPHVSFTDGTYDGRYAFMNDKANSRVARVRLDV
MKCDKIIELPNQHTVHGLRLQKYPRTGYVFCNGEDGVPLPNDGKVLDNPKEYHSIFTALD
GDTMKVAWQVMVSGNLDNVDSDYQGKYCFSTCYNAEEGVTLAEMTANEQDWVVIFNLKRI
EEAVKKGDFKEMNGVPVIDGRKGSPYTRYVPVSNNPHGMNTAPDGIHIVAAGKLSPTVTV
MDVRLFDQLFDDKIKPRDVVVAEPELGLGPLHTAYDGKGNAYTTLFLDSQVVKWNIDLAK
RAFKGEKVDPIIQKLDVHYQPGHNHSSMGQTKEADGKWLISLNKFSKDRFLNVGPLKPEN
DQLIDISGDQMKLVHDGPSFAEPHDATIVHRSKINPISIWDRADPMFADAVKQAKADGIN
LEADSKIIRDGNKVRVYMTSTAPAFGLEQFQVKQGDQVTVYITNIDAVEDLTHGFCIVNY
GIQMEVAPMATASVSFSADKAGVYWYYCSWFCHAMHMEMKGRMFVEPKSV
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagcgacaacatcaagggcgtcagccggcgaacgctgctggggaccacggcg
gccgctgcgggcgtgggacttgccggcggggcggtggtaacaaaggacggcgcgggcttc
gtctcgaccgccgacgcgcagaccaaatctgccgcacccaaggcaccgccggcgcgtccg
gccgtgcagaagaccgaagtcgcgccgggcgagctcgacgaatattacgtcttcttttcg
agtggccaatccggcgagatgcggatcatcgggctcccctcgatgcgcgaactgatgcgc
gttccggtcttcaaccgctgcagcgcgaccggctggggccagaccaacgaaagcctgaag
gttttgacagaagggatgcagccggcgacccgcgaattcctcaagaaccgtggcggcacg
ttcatgaacggcgacctccaccatccgcacgtctccttcacggacggcacctacgacggc
cgctacgccttcatgaacgacaaggccaacagccgcgtagcgcgggtgcggctcgacgtc
atgaagtgcgacaagattatcgaactgccgaatcagcacaccgtccacggccttcggctg
cagaagtatccacgaaccggatatgtgttctgcaacggggaagacggcgttccgctgccg
aacgacggcaaggttctcgacaacccgaaggaatatcactccatcttcacggcgctcgac
ggcgataccatgaaagtggcctggcaggtgatggttagcggcaatctcgacaacgtcgat
tccgactaccaaggcaaatactgcttctcgacctgttacaacgccgaagaaggcgtcact
ctggccgagatgaccgccaacgagcaggactgggtcgtcatcttcaacctcaagcggatc
gaggaggcagtgaagaagggtgatttcaaggaaatgaacggcgtgcccgtgatcgacggt
cgcaagggctcgccctacacgcgctacgttccggtgtcgaacaatccgcatggcatgaat
accgcgcccgacggcatccacatcgtcgcggcaggcaagctgtcgccgacggtgacggtg
atggacgttcggctgttcgaccaactgttcgacgacaagatcaaaccgcgcgacgtcgtg
gtcgccgagcccgaactcggcctcgggccgctgcatacggcctacgacggcaagggcaac
gcctacacgacgttgttcctcgacagccaggtcgtcaaatggaacatcgatctcgccaaa
cgagcctttaagggcgagaaggtcgatcccatcatccagaagctcgacgtccactatcag
cctggccacaatcactcctcgatgggtcagaccaaggaggccgacggaaaatggctgatc
tcgctgaacaagttttcgaaggaccgctttctcaacgtcggcccgctgaagccggagaac
gatcagttgatcgacatctcgggcgaccagatgaaactggtccatgacggtcctagcttc
gccgagccgcatgacgccaccatcgtgcaccgttccaagatcaacccgatctcgatctgg
gaccgcgccgatccgatgtttgccgatgcggtcaagcaagccaaggccgacgggatcaac
ctggaggcggattccaagatcatccgcgacggcaacaaggtgcgggtctatatgacctcg
accgctccggcgttcgggctcgagcagttccaggtcaagcagggcgatcaggtcaccgtc
tacatcaccaacatcgatgcggtcgaagacctgacgcacggcttctgcatcgtgaactac
ggtatccagatggaggtcgcgccgatggcgaccgcgtcggtgtcgttcagcgccgacaag
gcgggcgtctactggtactactgctcctggttctgccacgccatgcacatggagatgaag
ggccgcatgttcgtcgagccgaaatcggtctga

DBGET integrated database retrieval system