KEGG   Bradyrhizobium diazoefficiens USDA 110: blr0467
Entry
blr0467           CDS       T00109                                 

Symbol
ccmA
Name
(GenBank) heme exporter protein A
  KO
K02193  heme exporter protein A [EC:7.6.2.5]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bja00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    blr0467 (ccmA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bja02000]
    blr0467 (ccmA)
Enzymes [BR:bja01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.5  ABC-type heme transporter
     blr0467 (ccmA)
Transporters [BR:bja02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Heme transporter
    blr0467 (ccmA)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_16 AAA_15 AAA_23 NACHT DUF3584 Zeta_toxin AAA_30 DUF87 AAA_13
Other DBs
NCBI-ProteinID: BAC45732
UniProt: P30963
Position
508457..509059
AA seq 200 aa
MQLSGRRVICVRGGREVFAGLDFEAVSGEAVAVVGRNGSGKTSLLRLIAGLLIPAGGTIA
LDGGDAELTLPEQCHYLGHRDALKPALSVAENLSFWADFLGGERLDAHESLATVGLDHAT
HLPAAFLSAGQRRRLSLARLLTVRRPIWLLDEPTTALDVAGQDMFGGLMRDHLARGGLII
AATHMALGIDSRELRIGGVA
NT seq 603 nt   +upstreamnt  +downstreamnt
atgcagctttccggacgtagggtgatctgtgtgcggggcggccgcgaggtgtttgccgga
ctcgatttcgaggccgtctccggcgaggccgtggcggtcgttggccgcaacgggtcgggc
aagacctcgctgctgcggctgatcgcggggctgctcattccggctggcgggacgatcgcg
ctcgatggcggcgatgccgagctgacattgcctgagcaatgccactatctcggccatcgc
gacgccctgaagccggcgctgagcgtggcggaaaatctgtcattctgggccgattttctg
ggcggcgagcgacttgatgcccatgagagcctcgccacggtcgggctcgaccacgccacc
cacctgccggcagcttttctgtcggccggccagcgccgccggctctcgctggcccggttg
ctgacggtgcgccgcccgatctggctcctggacgagccgaccacggcgctggacgtcgcc
ggccaggacatgttcggcggcctgatgcgcgaccatctcgcccgcggcggcctgatcatc
gcggcgacccacatggcgctggggatcgattcgcgggagctgcggatcgggggtgtggca
tga

DBGET integrated database retrieval system