KEGG   Bradyrhizobium diazoefficiens USDA 110: blr0468
Entry
blr0468           CDS       T00109                                 

Symbol
ccmB
Name
(GenBank) heme exporter protein B
  KO
K02194  heme exporter protein B
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bja00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    blr0468 (ccmB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bja02000]
    blr0468 (ccmB)
Transporters [BR:bja02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Heme transporter
    blr0468 (ccmB)
SSDB
Motif
Pfam: CcmB
Other DBs
NCBI-ProteinID: BAC45733
UniProt: P30964
Position
509370..510038
AA seq 222 aa
MTALSALIRRDIRIALRVGGGALIGVLFFLTVVVLMPFAVGPDLALLSRLGPAILWLGAL
LASLLTLDRLFMADHEDGSLDLITMSRTPLELACAAKALAHWLAAGLPLIVATPVLGLLL
NLDMVATGAVALTLLAGTPALTFTGMIGAALAVTLHRGGLLMAVLVLPLSIPVLIFGVAA
SQAVIVGPMSFGAPFSILCALSLVSLVIGPFAAAASLRHGLD
NT seq 669 nt   +upstreamnt  +downstreamnt
atgaccgccctgtccgccctcatccgccgggatatcaggatcgcgctccgcgttggcggc
ggggcgctgatcggcgtgctgttcttcctgaccgtggtggtgctgatgccgttcgcggtg
gggccggacctcgcgttgctgtcgcggctggggccggccattctctggctcggcgccctg
ctggcgagcctgctgacgctggaccggctgttcatggccgaccatgaggacggctcgctc
gacctgatcacgatgagccggacgccgctggaactcgcctgcgcggcgaaagcgctggcg
cattggctggcggcgggcctgccgctgattgtcgcaacccccgtgctcgggctcttgctg
aatctcgacatggtcgcgaccggcgcggtggccctgacgctgctcgcgggcacgccggcc
ctgacctttaccggcatgatcggcgccgcgctggcggtgacgctgcatcgcggcgggctt
ttgatggcggttctggtgctgccgctgtcgatcccggtgctgatcttcggggtcgcggcc
tcccaggccgtgatcgtcggtcccatgtcgttcggcgcgccgttctcgatcctgtgcgcg
ctgtcgctggtcagcctcgtgatcggccccttcgccgcggcggcgagcctgcggcatggt
ctcgactga

DBGET integrated database retrieval system