KEGG   Bradyrhizobium diazoefficiens USDA 110: blr0471Help
Entry
blr0471           CDS       T00109                                 

Gene name
ccmG
Definition
(RefSeq) thiol:disulfide interchange protein
  KO
K02199  cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
KEGG Orthology (KO) [BR:bja00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bja03110]
    blr0471 (ccmG)
Chaperones and folding catalysts [BR:bja03110]
 Protein folding catalysts
  Protein disulfide isomerase
   blr0471 (ccmG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Redoxin AhpC-TSA Thioredoxin Thioredoxin_8 Thioredoxin_2
Motif
Other DBs
NCBI-GeneID: 1048774
NCBI-ProteinID: NP_767111
RhizoBase: blr0471
UniProt: P30960
Position
511100..511684
Genome map
AA seq 194 aa AA seqDB search
MSEQSTSANPQRRTFLMVLPLIAFIGLALLFWFRLGSGDPSRIPSALIGRPAPQTALPPL
EGLQADNVQVPGLDPAAFKGKVSLVNVWASWCVPCHDEAPLLTELGKDKRFQLVGINYKD
AADNARRFLGRYGNPFGRVGVDANGRASIEWGVYGVPETFVVGREGTIVYKLVGPITPDN
LRSVLLPQMEKALK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcagtcgacttccgcgaacccgcagcgccgcaccttcctgatggtgctgccg
ctgatcgccttcatcggcctggcgctgctgttttggttccggctcggcagcggcgatcct
tcgcggattccctccgcgctgatcggacggccggcgccgcagaccgcgctgccgccgctc
gagggattgcaggccgacaacgtccaggtgccggggctcgatcccgccgcgttcaagggc
aaggtcagccttgtcaacgtctgggcctcctggtgcgtaccctgccatgacgaggcgccg
cttctgaccgagctggggaaagacaagcgcttccagctcgtcggcatcaactacaaggac
gcggccgacaacgcccgccgcttcctcggccgctacggcaacccgttcggccgcgtcggc
gtggatgccaacggccgcgcctcgatcgaatggggcgtctatggcgtgccggagaccttt
gtcgtcggacgcgagggcaccatcgtctacaagctggtcggcccgattacgccggacaat
ctgcggagcgtgctgctgccgcagatggagaaggcgctgaagtag

DBGET integrated database retrieval system