KEGG   Bradyrhizobium diazoefficiens USDA 110: blr0960Help
Entry
blr0960           CDS       T00109                                 

Definition
(RefSeq) 5'-methylthioadenosine phosphorylase
  KO
K00772  5'-methylthioadenosine phosphorylase [EC:2.4.2.28]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00270  Cysteine and methionine metabolism
bja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    blr0960
Enzymes [BR:bja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.28  S-methyl-5'-thioadenosine phosphorylase
     blr0960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-GeneID: 1048928
NCBI-ProteinID: NP_767600
RhizoBase: blr0960
UniProt: Q89VT5
Position
1049956..1050831
Genome map
AA seq 291 aa AA seqDB search
MTQAVLGIIGGSGIYDLPGLEGAHEEVIKSPWGEPSAPLRRGTIAGLPIVFLPRHDKGHR
LSPSDINYRANIDVLKRAGVTDLISLSACGSFKEEMPPGTFVLVDQFVDRTHKRESSFFG
RGCVAHVSMAHPVSPRLRIHLAAAAEAEGIAIARGGTYVCMEGPQFSTYAESMTYKTSGY
SVIGMTNMPEAKLAREAEICYATVAMVTDFDCWHPDHDAVTVQDIIRVLTSNADKAKALV
ARLAKDFPREHEPCPIGSDRALDTALITAPEARDPELLKKLDAVAGRVLRG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggcggtattgggcatcatcggtggctccggcatctatgacctgccgggcctc
gagggcgcgcacgaagaggtgatcaagagcccgtggggcgagccgtcggcgcccctgcgg
cgcgggaccatcgcaggcctgccgatcgtgttcctgccgcggcacgacaagggccacagg
ctgtcgccctccgacatcaactaccgcgccaatatcgacgtgctgaagcgcgccggcgtc
accgacctgatctcgctgtcggcctgcggctcgttcaaggaagagatgccgcccggcacc
ttcgtgctcgtcgatcaattcgtcgaccgcacccacaagcgcgagagctcgttcttcggc
cgcggctgcgtcgcgcatgtgtcgatggcccatccggtctcgccgcggctgcgcatccat
cttgccgcggcggccgaggccgagggtatcgcaatcgcgcgcggcggcacctatgtctgc
atggaggggccgcagttctcgacctatgcggagagcatgacctacaagacatcaggctat
tccgtgatcggcatgaccaacatgcccgaggcgaagctcgcgcgcgaagcggagatctgc
tacgccacggtcgcgatggtgacggatttcgactgttggcatcccgaccatgacgccgtt
accgtgcaggacatcatccgcgtgctgacctcgaacgccgacaaggcgaaggcgctggtg
gcgcggctggcaaaggatttcccgcgcgagcatgagccgtgcccgatcggttcggaccgc
gcgctcgacaccgcgctgatcactgcgcccgaggcgcgtgatcccgagcttctgaagaag
ctcgatgccgtagcagggcgcgtgctacgtggctga

DBGET integrated database retrieval system