KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2505Help
Entry
blr2505           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
  KO
K06893  uncharacterized protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
KEGG Orthology (KO) [BR:bja00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    blr2505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SnoaL_2 PHZA_PHZB WI12 SnoaL DUF4440
Motif
Other DBs
NCBI-GeneID: 1050357
NCBI-ProteinID: NP_769145
RhizoBase: blr2505
UniProt: Q89SA0
Position
2731521..2732000
Genome map
AA seq 159 aa AA seqDB search
MISPTPPHGDAAMSAAANKKLMQDIFAAAANPDPGARDRALFTASLADDARWVVTGQYSW
SRTFTGKEAILNDLHGYVRTRLRDRTRTVAHRFIADSDIVVVEAKGDNVTPEGVRYDNDY
CLVFRLEGGRIKEIREYCDSVLTEKALGPFPQTPARAAS
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatctccccgacgccaccacacggagatgccgccatgagcgctgccgccaacaagaaa
ctgatgcaggatattttcgccgccgccgccaaccccgatccgggcgcgcgcgaccgcgcc
ctgttcaccgcaagcctcgccgacgatgccagatgggtcgtgaccggccagtattcctgg
tcgcgcaccttcaccggcaaggaagcgatcctcaacgatctgcacggctatgtgcgcacc
cgcctgcgcgaccggacgcgcaccgttgcccaccgctttatcgccgatagcgacatcgtc
gtggtcgaagccaagggcgacaacgtcacgccggaaggcgtgcgctacgacaacgattac
tgcctggtgtttcgcctggagggcggcaggatcaaggagatccgggaatattgcgactcg
gtcctgaccgagaaggcgctcggcccgtttccgcaaacacccgcgagggccgcgagctga

DBGET integrated database retrieval system