KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2521Help
Entry
blr2521           CDS       T00109                                 

Gene name
rnhB
Definition
(RefSeq) ribonuclease HII
  KO
K03470  ribonuclease HII [EC:3.1.26.4]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja03030  DNA replication
Brite
KEGG Orthology (KO) [BR:bja00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    blr2521 (rnhB)
Enzymes [BR:bja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     blr2521 (rnhB)
DNA replication proteins [BR:bja03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     blr2521 (rnhB)
   Elongation factors (archaeal)
     blr2521 (rnhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_HII
Motif
Other DBs
NCBI-GeneID: 1050309
NCBI-ProteinID: NP_769161
RhizoBase: blr2521
UniProt: Q89S84
Position
2754052..2754837
Genome map
AA seq 261 aa AA seqDB search
MIRDKSAKRPAKDAPKKAAVKEAAPVKASFRRERALIKRGIWPVAGCDEAGRGPLAGPVV
AAAVILDPDRIPRGIDDSKRLTAEQREKLFDKICATAQVSVAVASPARIDRDNILRASLW
ALKRAVVALPEAPRHVFVDGRDRLDTACDCEAVIGGDGIVLSIAAASIVAKVTRDRLMCA
LAQDCPGYGFEQHKGYGVPEHLDALNRLGPTVHHRSFFAPVAAARAKHMPWTVEPVRDLF
AATEVEVQLEASVEIDASANL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgattcgggataaatccgccaaaagaccggccaaggacgcgccaaagaaggctgctgta
aaggaggccgcgcccgtcaaggcgagcttccgccgcgagcgcgcgctgatcaagcgcggc
atctggccggttgcgggctgcgacgaggccggccgcgggccgctcgcaggtcccgtggtg
gcggccgcagtgattctcgaccccgaccgcattccccgtggcatcgacgattccaagcgc
ctgacggcggagcagcgcgaaaagctgttcgacaagatctgcgccaccgcgcaggtctcg
gtcgcggtcgcctcgcccgcgcggatcgaccgcgacaacatcctgcgcgcctcgctgtgg
gcgctgaagcgcgccgtggtggcgctgcccgaggcgccccgccacgtcttcgtcgacggc
cgcgaccggctcgatacggcatgcgactgcgaggccgtgatcggcggcgacggcatcgtc
ctgtcgatcgcggcggcgtccattgtcgccaaggtgacgcgcgaccggctgatgtgcgcg
ctggcgcaggactgcccgggctatggcttcgagcagcacaagggctacggcgtccccgag
catctcgacgcgctgaaccgcctcggcccgaccgtccaccaccgcagcttcttcgccccc
gtcgccgccgcccgcgccaagcacatgccctggacagtcgagccggtgcgcgacttgttc
gcggcgaccgaggtcgaggtgcagctggaagcaagcgttgagatcgacgcgtcggcgaat
ctctag

DBGET integrated database retrieval system