KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2522Help
Entry
blr2522           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT_2
Motif
Other DBs
NCBI-GeneID: 1050332
NCBI-ProteinID: NP_769162
RhizoBase: blr2522
UniProt: Q89S83
Position
2755083..2756591
Genome map
AA seq 502 aa AA seqDB search
MRFTSLVIELIRARPRLIVWIVVLLQAAMWLFVALAFYRSPPGTLATLLAFGREYQVGTD
LGPPLPVWLADIAYRAAGGHMFGVYVLAEVCEIATFIALYHLSRAVVGSQQAVLAVLLTM
TVLAFSSPALDFGPLVLARPLWALLLLHSWQIIGQRRGNAWFAWSIEAGLLLLTTPAAVF
LLLLLVVFAFATAGGRRTLLALDPLFALIVVAVLALPYAVWLMRAETLVLPALPAVAELS
TRAIHAAWLLGGLVLGAAAIPALTFLNTGLFLAKGEEAPIIYRPPVEPLARNFVYFFALA
PALGAVLISGLFGLESVVGGAGVVLVMSGLAVVVGAGDLIAMRRARMLRTVWAAAVVAPA
AGVVLAVLFLPWTGANEIATSMPARAISDFFDDSFARRTNHRLRAVAGETQLASLIALHS
GRPHLFIDAEPARTPWINQAKFSETGGVVVWRAADTAGTPPPDILKRFPGIVPEVPRAFE
WLVTGRQQLLRIGWAIVRPKGA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttacctccctggtcatcgagctcattcgcgcccggccgcggctgatcgtgtgg
atcgtcgtgctgctccaggccgcgatgtggctgttcgtggcgctggcgttctatcgcagc
ccgcccggcacccttgcgaccctcctggccttcggcagggaataccaggtcggcaccgat
ctcggcccgccgctgccggtctggctcgccgacatcgcctatcgcgccgcgggcggccac
atgttcggcgtctatgtgctggccgaggtctgcgagatcgcgaccttcatcgcgctctat
catctctcccgcgccgtggtcggctcgcagcaggcggtgctggccgtgctgctgacgatg
acggtgctggccttctcctcgcccgcgctcgatttcggcccgctggtgctggcgcgaccg
ctgtgggcgctgctgctgctgcattcctggcagatcatcggccagcgccgcggcaacgcc
tggttcgcctggtcgatcgaggccgggctcttgctgctgacgacgcccgcggcggtcttc
ctgctcctgctgctcgtcgtcttcgcgtttgcgaccgccggcggccgccgcacgctgctc
gcgctcgacccgctgttcgcgctgatcgtcgtcgccgtgctcgcgctgccctatgccgtc
tggctgatgcgcgccgagacgctggtcctgccggccctgcctgcggtcgccgagctgagc
acccgcgcgatccacgcggcctggctgctcggcgggctcgtgcttggcgcggcggcgatc
ccggcgctgactttcctcaacaccggcctgttcctcgccaagggcgaggaggcgccgatc
atctaccgcccgccggtcgagccgctggcgcgcaacttcgtctatttcttcgcgctggcg
ccggcgctcggtgcggtgctgatctccggcctgttcgggctcgagtccgtcgtcggcggt
gccggcgtggtactggtgatgtcggggctcgccgtggtggtgggtgccggcgatctcatc
gcgatgcgccgcgcgcggatgctgcggacggtgtgggccgccgccgtcgtggcgcccgcc
gccggcgtcgtgctcgccgtcctgttcctgccctggaccggcgccaatgagatcgcgacc
tcgatgccggcgcgtgcgatctcggattttttcgatgacagctttgcccgccgcaccaac
catcgcctgcgtgcggtggccggcgagacccagcttgcgagcctgatcgcgctgcattcc
ggccgcccacatctgttcatcgatgccgagcccgcgcgcacgccgtggatcaatcaggcc
aagttcagcgagaccggcggcgtcgtggtctggcgcgccgccgacaccgcgggcacgccg
ccgccggacatcctcaagcgctttcccggcatagtgccggaagtgccgcgcgccttcgaa
tggctggtgaccggccgccagcagctgctgcgcatcggctgggccatcgtgcggccgaag
ggggcctaa

DBGET integrated database retrieval system