KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2547Help
Entry
blr2547           CDS       T00109                                 

Definition
(RefSeq) methyl accepting chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja02020  Two-component system
bja02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bja00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    blr2547
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    blr2547
Bacterial motility proteins [BR:bja02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    blr2547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal HAMP Trep_Strep DUF1664 DUF948 Reo_sigmaC DUF2516
Motif
Other DBs
NCBI-GeneID: 1050246
NCBI-ProteinID: NP_769187
RhizoBase: blr2547
UniProt: Q89S58
Position
2788820..2790871
Genome map
AA seq 683 aa AA seqDB search
MQASSPQYSARPAALPALRINRLGAHSMSGLSIRLTHKVMAIGLFGLLGLVAFGAIYEIG
SLSQDASRDIANRARAIADLDKQLSIEMLEARRNEKNFLQRRAESYAKAHAELIGPINRD
FDEVQRLMAAGGMSVLSDKMKQAQDGFKRYASDFGALVAAETRLGLNETVGLSGSLRAAV
HDIEAKLKEIDDPRTTTWMLMMRRHEKDFMLRRDPKYIAEVKKAAVEFSKAIEVVAIPTA
AMNDIMAKLQKYQSEFTAWAETAQQSAALDASMMKTFREVEPVMAEVRTAVDAMSRRADA
AEAATREAVRLWMVVAFGVTVIVLAAVGFLLGRSISKALGAMIGAMTRLARGELSISVPG
VGRRDEIGEMAGAVEVFRTNMAEAERLRAEQAEADARGREQRKADMQRLADRFEGAVGEI
IETVSSAATELEASSNTLTQAAERGNGLATAVAAASEEASANVQSVSSASEEMTSSISEI
SRQVQESARVADVAVGQAQRTNARVAELTKAASRIGDVVELINTIAAQTNLLALNATIEA
ARAGEAGKGFAVVATEVKALAEQTAKATGEIGQHIGAIQAATDDSVGAIKEIGDTIARMS
EISSTIAAAVEEQGAATQEISRNIQHAAHGTSEVSANIADVQRGAGETGAASAQVHSAAH
SLSQESNRLKSEVARFLESVRAA
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcatcatctccgcaatattccgcgcgcccagccgccctccctgcattgcgtatc
aatcgtcttggagcacattccatgagtggcctttccattcgcctcactcacaaggtcatg
gcgatcggactgttcggactgttgggtctcgtcgccttcggcgcgatctacgagatcggc
agcctttcccaggacgcatcgcgcgacattgccaatcgtgcccgcgcgatcgctgatctc
gacaagcagctctcgatcgagatgctggaggcacgccgcaacgagaagaacttcttgcag
cgccgggccgagagctacgccaaggcgcatgccgagctgatcgggccgatcaaccgcgat
ttcgatgaggtgcagcggctgatggcggcgggcggcatgagcgtgctgtccgacaagatg
aagcaggcccaggacggcttcaagcgatacgcgtcggacttcggcgcattggtggccgcc
gagaccaggctcggtctgaacgagacggtcggcctgtccggttcgctccgcgccgcggtg
cacgacatcgaggccaagctgaaggagatcgacgatcccaggacgacgacctggatgctg
atgatgcgccggcacgagaaggacttcatgctacggcgcgaccccaagtacatcgccgag
gtgaagaaggccgcggttgaattctccaaggcgatagaggtcgtcgcaatcccgacggcg
gcgatgaacgacatcatggccaagctccagaaataccagtccgagttcacggcctgggcc
gagaccgcgcagcagagcgcggcccttgacgccagcatgatgaagaccttccgcgaggtc
gagcctgtcatggcggaggtgcggaccgcggtcgatgcgatgtccaggcgggcggacgcc
gccgaagctgccacgcgcgaggccgtgcgtctttggatggtcgtcgccttcggcgtcacc
gtcatcgtgcttgccgccgtcggcttcctgctgggacgctcgatctcgaaggcactcggt
gcgatgatcggtgcgatgacccggcttgcgcgcggcgagctctcgatttccgttcccggc
gtcggccgcagggacgagatcggcgagatggccggtgcggtcgaggtgttcaggaccaac
atggcggaagccgagcggctgcgcgccgaacaggcggaagcggacgcgcgcgggcgcgaa
cagcgcaaggccgacatgcagcggctcgccgacaggttcgaaggcgcggtcggcgagatc
atcgagaccgtgtcgtcggcggcaaccgagctcgaggcctcctccaacacgctgacgcag
gccgccgagcgcggcaacgggcttgccaccgccgtggcggcggcctcggaagaggcgtcc
gccaacgtgcagtcggtgtcatccgcgagcgaggagatgacctcctcgatctccgagatc
agccgccaggtgcaggaatcggcgcgcgtcgccgacgtcgcggtcgggcaggcccagcgc
accaatgcgcgcgtcgccgaattgaccaaggcggcctcccggatcggcgacgtggtggag
ctgatcaacaccatcgccgcccagaccaacctgctggcgctcaacgcgacgatcgaggcg
gcgcgggcgggcgaggccggcaagggctttgcggtggtcgcaaccgaagtgaaggcgctc
gccgagcagaccgcgaaggccacgggcgagatcggccagcacatcggtgcgatccaggcc
gcgacggacgactccgtcggcgcgatcaaggagatcggcgacaccatcgcgcggatgtcg
gagatctcgtcgaccatcgcggccgcggtggaggagcagggcgccgcgacgcaggagatc
tcccgcaacatccagcatgccgcgcacggcacctccgaagtctcggcgaatatcgccgac
gtccagcgcggtgccggcgagaccggagccgcctcggcgcaggtgcattcggccgcgcat
tcgctgtctcaggagagcaaccggctgaagagcgaggtcgcgcgcttcctggagtcggtg
cgggcggcgtga

DBGET integrated database retrieval system