KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2556Help
Entry
blr2556           CDS       T00109                                 

Definition
(RefSeq) thiosulfate sulfurtransferase
  KO
K01011  thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00270  Cysteine and methionine metabolism
bja00920  Sulfur metabolism
bja01100  Metabolic pathways
bja01120  Microbial metabolism in diverse environments
bja04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    blr2556
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    blr2556
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    blr2556
Enzymes [BR:bja01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     blr2556
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     blr2556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-GeneID: 1050169
NCBI-ProteinID: NP_769196
RhizoBase: blr2556
UniProt: Q89S49
Position
2800962..2801831
Genome map
AA seq 289 aa AA seqDB search
MPQPAPLISTEQLAAILGDPALRLYDCTTYNEPVPPGSDLPYRAVPGDKTFAARHIPGAD
FLDLQGEFSDASAQQFFMMPGVAQLEAAFGRHGLDASKTIVLYSIGTMMWATRFWWMLRS
LGVDALVLDGGFDKWKEEGRPVETGTPKGYPATTFKATPRAGFFVDKNVVKARIGDPATV
IVNALGPQFHRGLEPSRYGRPGRVPGSVNVSAATLTNADKTLTSLADAEAKFAAQGVTRD
KTVICYCGGGISATIDLLLLTQLGFDKLTLYDASMGEWARDPSLPIETD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgccccaaccggcacccctcatctccaccgaacaactcgccgccatcctcggcgatccc
gccttacgcctctacgactgcacgacctataacgaaccggtgccgccaggcagcgacttg
ccgtatcgtgccgttcccggcgacaagaccttcgcggcgcgccacatccccggcgccgat
ttcctcgatcttcagggcgagttctccgacgcctccgcgcagcagttcttcatgatgccc
ggtgtggcccagctcgaagctgccttcggccgccatggcctcgatgcgtccaagaccatc
gtgctctacagcatcggcacgatgatgtgggcgacgcggttctggtggatgctgcgctcg
ctcggcgtcgacgcgcttgtgctcgacggcggtttcgacaaatggaaggaagaggggcga
ccggtcgagaccggcacaccgaagggctaccccgccacgaccttcaaggccacaccgcgc
gcgggcttctttgtcgacaagaatgtcgtgaaggcgcggataggcgatcccgcgaccgtg
atcgtcaatgcgctcgggccgcagtttcatcgcggcctcgagccgagccgctacggccgg
cccggccgagttccaggcagcgtcaacgtatcagccgcaacgctcacaaatgcggacaag
acgctgacgagccttgccgatgccgaagcgaaattcgccgcccagggcgttacgcgcgac
aagaccgtgatctgttattgcggcggtggcatctcggcgacgatcgacctgttgctgctg
acgcagctcggcttcgacaagctgacgctttacgacgcatcgatgggcgaatgggcgagg
gatccgtcgctgccgatcgagaccgactag

DBGET integrated database retrieval system