KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2558Help
Entry
blr2558           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
  KO
K08995  putative membrane protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
KEGG Orthology (KO) [BR:bja00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    blr2558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4142 DUF2383
Motif
Other DBs
NCBI-GeneID: 1050204
NCBI-ProteinID: NP_769198
RhizoBase: blr2558
UniProt: Q89S47
Position
2802660..2803244
Genome map
AA seq 194 aa AA seqDB search
MKQRAGGPRPAAQECQTMFIRRSAAVAAAILLSSPALLQGAGAADKPTDPQIAHIAYTAG
VIDINAAKQAQKQAQNKDVKAFAEDMLRDHEAVNKQALALVKKLNVTPEDNDTSKALSKQ
ASDKLAELDKLSGAAFDKAYVVNEVAYHKAVNGALETQLIPSANNAELKSLLQTGLKIFQ
GHQQHAEHVAAELK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaacgcgccggcggaccccgtccggcagcacaggagtgtcaaaccatgttcatt
cgacggagcgcggctgttgccgcagcaatcttgttgtcgagccccgcgctgctgcaaggc
gccggcgcagccgacaagccgaccgatccgcagatcgcccatatcgcctacaccgcgggc
gtgatcgacatcaacgccgccaagcaggcgcagaaacaggcgcagaacaaggacgtcaag
gcgtttgccgaggacatgctgcgcgaccacgaggccgtcaacaagcaggcgctcgcgctg
gtcaagaagctgaacgtcacgcccgaggacaacgacaccagcaaggcgctgtcgaagcag
gcgagtgacaagctggctgagctcgacaagctgagcggcgcggccttcgacaaggcctat
gtcgtcaacgaggtcgcctaccacaaggcggtcaacggtgcgctggagacccagctgatt
ccgtcggcgaacaatgccgagctgaagagcctgttgcagaccggcctgaagattttccag
ggccatcagcagcacgccgagcacgtcgcggccgagctgaaatag

DBGET integrated database retrieval system