KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2571Help
Entry
blr2571           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 1050170
NCBI-ProteinID: NP_769211
RhizoBase: blr2571
UniProt: Q89S34
Position
2812691..2814064
Genome map
AA seq 457 aa AA seqDB search
MRQTRRYKPTSCRSVAQPGRALRSGRRGRRFESCHSDHSFKSYRFPEAWRTGRRRLGSAF
LQRFSGRVHGRFGPSRAVCARGMARKARPAGQRLDGVKRVARFTNANGVVGAGFAPASSA
AEKFNLSWHSFCNTHYALFFFFLRHCAMELTPNNLDQLSGIAQCLDDQWAPPDIAQEAAE
SEKPLSDYAKRIQPAMKMEFFKALLTLRSVVVNRAYLLHNEAVKELYLGGDSEAESFERL
VQERAIIPFLYDERQLSDFKGTDLSRDVEDYWVKAEAKGTNKLRLSWDDKRNGTLITDHI
SKRFGGFFKTIDDLRPDLLRNDFSLSTFDDESIRQMLKNMRDFANRVQDETGRPVKRKEI
YHEFVCVGGLHKDHLVFDLKKPLAMQIKALADLKYNVNLPDVLNRYVVTSQGSTSRECLQ
EIKELTEGIKEVDEKELQDLMMAVAGVGLDIASAPFN
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccaaacccgacgctataagccgacctcttgtcggagtgtggctcagcccggtaga
gcactgcgttcgggacgcaggggtcgcaggttcgaatcctgccactccgaccattctttc
aaaagttaccgttttccagaggcttggcggaccggccgccggcgcctcgggagcgccttt
ttgcaacgattttcggggcgggtccacggccgatttggcccaagcagggccgtctgtgcg
cgcggcatggctcgcaaagctcgtcccgccggccagcgccttgatggcgtgaagcgcgtc
gcaaggttcacgaacgcgaatggtgtcgttggagcaggattcgctccggcttcttcggct
gccgaaaagttcaacttaagctggcattcattttgtaatacacattacgcattgtttttt
ttcttcttaaggcattgcgccatggaattgacccccaacaatttggaccagctttccggc
attgcccaatgccttgacgatcagtgggccccgccggatatcgcccaggaagctgcagaa
agtgaaaagccgctttccgactacgccaagcggatacagccggcgatgaagatggagttc
ttcaaggcgctgctcacgctgcgttcggtggtggtcaatcgcgcgtaccttctccacaat
gaggcggtcaaggagctctatctcggcggagattcggaggcggaatcgttcgaaagactc
gtgcaggaacgcgcaatcatcccattcctctacgacgagcggcagctctcggacttcaag
ggcacggacctgtcccgcgatgtcgaggactactgggtcaaggccgaggcgaagggtacc
aacaagctgcgattgagttgggacgacaagcgaaacgggaccctgatcaccgatcacatt
tccaagcgctttggaggtttcttcaagacgatcgacgatctcaggcctgatctgcttcgc
aacgacttctcgctttcgacattcgatgacgagagcatcaggcagatgctcaagaatatg
cgcgactttgccaatcgggtgcaggacgagaccggccgcccggtcaaacgcaaggaaatc
tatcacgagttcgtctgcgtcggcggcctgcacaaggaccacctggtttttgatctcaag
aagccgctggccatgcagatcaaggcgctcgcggacctcaagtacaacgtcaatttgccg
gatgttctcaaccgctatgttgttacgtcccaggggtcgaccagccgtgagtgtttgcag
gagatcaaggagctcacggagggtatcaaggaggtggacgagaaggagttgcaggatctc
atgatggctgtcgccggggtcggtctggacatcgccagtgcgccgttcaattga

DBGET integrated database retrieval system